Citrus Sinensis ID: 044130

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-----

MHYGKKLEYKGEEALKEIEKLTAKADEVQNNLLREILIRNGETEYLRKYLRGSKDVSDFKRCVPVSTYKNIYPYIQRIAISGEDSSLISGHPITEMLCRYICGLDEGKAMYFYFVKAEMSTPSGLPTRTVLTSYYKSKHFKCRTRDPYNDFTSPDPAILCNDSNQSMYCQLLAGLIHRHQVLRLGAVFASALLRAISFLERNWFQLCNDIRSGRLDLTITDPGCRSSTLSLLTSPNPTLADEIEEICSRPSWKGILCQLWPRAKYIEAVVTGSMAQYIPSLEYYSAGKLPLVGTMYASSECYFGVNLKPLSNPADVSFTLLPNMCYFEFLPLGGENGTLLSMEFNEEEEVPNDKLVDLGHVRVGHYYELVVTTFAGLNRYRIGDVLQVTGFYNRAPQFRFICRRNVVLSIDNDKTNEEDLHKSVTIAKNLLEPYSALLVEYTSYADTSTVPGHYVLYWEIQIVDSPALPLDHQKVLEECCIAVEEQLDYVYRRCRSHDKSVGPLEIRVVEPGTFETLMDLLVSQGGSINQYKTPRCIKSNNAALMLLDSHVKDSFFSPRDPKWIP

ccccHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHcccccccccHHHHHHHHHHcccccccccccccHHHHHHcccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHccccccccHHHHHHHHHcccccccccccccccccEEEEEEcccccccHHHHHHHHcccccEEccccccccCEEEEEccccccccccEEEEcccCEEEEEEEcccccccccccccccccccccccEEEccccccccEEEEEEEcccCEEEEccccEEEEEEECccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEECccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccccccEEEEEcccccHHHHHHHHHHcccccccccccCECcccHHHHHHHHcccccECcccccccccc

***GKKLEYKGEEALKEIEKLTAKADEVQNNLLREILIRNGETEYLRKYLRGSKDVSDFKRCVPVSTYKNIYPYIQRIAISGEDSSLISGHPITEMLCRYICGLDEGKAMYFYFVKAEMSTPSGLPTRTVLTSYYKSKHFKCRTRDPYNDFTSPDPAILCNDSNQSMYCQLLAGLIHRHQVLRLGAVFASALLRAISFLERNWFQLCNDIRSGRLDLTITDPGCRSSTLSLLTSPNPTLADEIEEICSRPSWKGILCQLWPRAKYIEAVVTGSMAQYIPSLEYYSAGKLPLVGTMYASSECYFGVNLKPLSNPADVSFTLLPNMCYFEFLPLGGENGT********EEEVPNDKLVDLGHVRVGHYYELVVTTFAGLNRYRIGDVLQVTGFYNRAPQFRFICRRNVVLSIDNDKTNEEDLHKSVTIAKNLLEPYSALLVEYTSYADTSTVPGHYVLYWEIQIVDSPALPLDHQKVLEECCIAVEEQLDYVYRRCRSHDKSVGPLEIRVVEPGTFETLMDLLVSQGGSINQYKTPRCIKSNNAALMLLDSHVKDSFFSPR**K***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHYGKKLEYKxxxxxxxxxxxxxxxxxxxxxLLREILIRNGETEYLRKYLRGSKDVSDFKRCVPVSTYKNIYPYIQRIAISGEDSSLISGHPITEMLCRYICGLDEGKAMYFYFVKAEMSTPSGLPTRTVLTSYYKSKHFKCRTRDPYNDFTSPDPAILCNDSNQSMYCQLLAGLIHRHQVLRLGAVFASALLRAISFLERNWFQLCNDIRSGRLDLTITDPGCRSSTLSLLTSPNPTLADEIEEICSRPSWKGILCQLWPRAKYIEAVVTGSMAQYIPSLEYYSAGKLPLVGTMYASSECYFGVNLKPLSNPADVSFTLLPNMCYFEFLPLGGENGTLLSMEFNEEEEVPNDKLVDLGHVRVGHYYELVVTTFAGLNRYRIGDVLQVTGFYNRAPQFRFICRRNVVLSIDNDKTNEEDLHKSVTIAKNLLEPYSALLVEYTSYADTSTVPGHYVLYWEIQIVDSPALPLDHQKVLEECCIAVEEQLDYVYRRCRSHDKSVGPLEIRVVEPGTFETLMDLLVSQGGSINQYKTPRCIKSNNAALMLLDSHVKDSFFSPRDPKWIP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative indole-3-acetic acid-amido synthetase GH3.9	Catalyzes the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	probable	O82243
Probable indole-3-acetic acid-amido synthetase GH3.1	May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	probable	Q8LQM5
Probable indole-3-acetic acid-amido synthetase GH3.11	May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	probable	P0C0M3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B2G, chain A
Confidence level:very confident
Coverage over the Query: 8-516,533-565
View the alignment between query and template
View the model in PyMOL