Citrus Sinensis ID: 044158

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890--

WVDESYSDCCQWQSVLCNATTSRVIAIDLLSLNIASALYLNFSLFTPFQQLESLDLSGNNIAGCVENEGLEKLSGLSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEELDSLSNLEGLDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELAHLQELYIDHNDFIGSLPWCLANLTSLRVLHVPDNQLTENLSSSPLMHLTSIELLILSNNHFQIPMSLEPFFNYSKLKIFHGRENQIFGEIESSHSSLTPKFQLTSISLSDHGDSDGGTIPKFLYHQHHLEFVIISDVNMRGEFPSWLLENNTNLRSIILANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLTISFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKINLTKLKRLNLDGNHFIGGIPESLSNCSSLQGLYISDNDISGSIPTWMGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGRPLNGAFSKCSYLLTLDLCNNRLNGNIPNWMGRLSQLRYLILANNNFEGEVPLRLCQLQKLRLLDLSHNNFSGQIPPCLDNTSLHREEGYYDLIPTYRNEYDIVSYNVGPSMGEKETIDFTTKERSYTYKGQPLESIHGLDLSCNKLIGEIPSRIGELIRIHTLNLSRNNLTGTIPVTFSNLRQVESLDLSYNNLTGKIPPRLVELNALAVFTVAHNNLSGKIPERIAQFATFDEDSYEGNPFLCGPPLPKICNENRSSTEASTHDNEEDDNLIDMDSFYITFTVSSVIVILGIIGVLWANPYWRHRWFYLVEILITSCYYFVVHNLIP

ccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccCECcccccccccccccccEEEcccccccccccccHHHcccccccEEEccccccCECccHHHHHccccccEEEcccccccccccccccccccccEEEccccCEEECcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEccccccCCcccccccccccccEEEcccccccccccccccccccccEEEccccccCECccccccccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccEEEccccccccccccHHHcccccccccccccccccccccccCCcccccccccEEEEEEECcccCEECccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcEEEEEEEEEccc

*****YSDCCQWQSVLCNATTSRVIAIDLLSLNIASALYLNFSLFTPFQQLESLDLSGNNIAGCVENEGLEKLSGLSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEELDSLSNLEGLDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELAHLQELYIDHNDFIGSLPWCLANLTSLRVLHVPDNQLTENLSSSPLMHLTSIELLILSNNHFQIPMSLEPFFNYSKLKIFHGRENQIFGEIESSHSSLTPKFQLTSISLSDHGDSDGGTIPKFLYHQHHLEFVIISDVNMRGEFPSWLLENNTNLRSIILANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLTISFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKINLTKLKRLNLDGNHFIGGIPESLSNCSSLQGLYISDNDISGSIPTWMGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGRPLNGAFSKCSYLLTLDLCNNRLNGNIPNWMGRLSQLRYLILANNNFEGEVPLRLCQLQKLRLLDLSHNNFSGQIPPCLDNTSLHREEGYYDLIPTYRNEYDIVSYNVGPSMGEKETIDFTTKERSYTYKGQPLESIHGLDLSCNKLIGEIPSRIGELIRIHTLNLSRNNLTGTIPVTFSNLRQVESLDLSYNNLTGKIPPRLVELNALAVFTVAHNNLSGKIPERIAQFATFDEDSYEGNPFLCGPPLP**********************LIDMDSFYITFTVSSVIVILGIIGVLWANPYWRHRWFYLVEILITSCYYFVVHNLIP

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EZG, chain A
Confidence level:very confident
Coverage over the Query: 574-644,697-780
View the alignment between query and template
View the model in PyMOL

Template: 4EZG, chain A
Confidence level:very confident
Coverage over the Query: 453-545,571-632
View the alignment between query and template
View the model in PyMOL

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 329-643,696-765
View the alignment between query and template
View the model in PyMOL

Template: 2ID5, chain A
Confidence level:very confident
Coverage over the Query: 382-516,541-643,696-811
View the alignment between query and template
View the model in PyMOL

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 80-247,351-643,696-787
View the alignment between query and template
View the model in PyMOL

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 78-280,359-369,381-645,698-763
View the alignment between query and template
View the model in PyMOL

Template: 1H6T, chain A
Confidence level:very confident
Coverage over the Query: 51-265
View the alignment between query and template
View the model in PyMOL

Template: 2Z63, chain A
Confidence level:very confident
Coverage over the Query: 49-225,251-292,304-397,425-640
View the alignment between query and template
View the model in PyMOL

Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 9-25,39-264,343-403,418-639
View the alignment between query and template
View the model in PyMOL

Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 13-278,331-417,443-512,531-611
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 49-270,325-354,379-806
View the alignment between query and template
View the model in PyMOL

Template: 3RIZ, chain A
Confidence level:confident
Coverage over the Query: 147-456,477-814
View the alignment between query and template
View the model in PyMOL