Citrus Sinensis ID: 044164

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710----
MAATTVSKVPNFHDILPDAIMSNIFSLITDTRTRNAMSLVCLKWCKLERSTRKSLALRGNIRDLNQVPVCFQAINNLDLSCLSPWGHPLLESSSNPSLLAKLLSHAFPSVVSLTIYARSPLTLHFLAPEWPKLSHVKLVRWHQRFNAPIGYDFFALFEHCPSLSSIDLSHFYCWTEDLPTAFELYPSIAASLSHLNLLVGHSFTEGYKSHELLSITSACPNLSQLLATCVFDHRFLGFVGDETLLSIASNCPRLSLLHLADSTALSSNSSRADPNNNDEGYASEDARISPTALGDFFESLPLLEELVLDVGNNVRDTWPALELLNSKCPRLKSLKLGQVHGICREIDSSMPAAGVALWKGLESLSIKNSADLTDSALIAISLGCSNLTKFEVQGCNKITKMGMQIFARVLEKTLVDVRISSCKYLNTVCSLQALEPIRDRIQRLHVDCVWESVEQYSQDHEIRGESSSSSHEACGFKDFQTEKRIMMSEEEASLKKKAKCCDGSGNGFSSCSDTWTKLKYLSLWIAVGELLNPIRLAGLENCPILEEIQIKVVGDCRNQQKPVFMAEFGLNSLVNYPQLSRMHFDCGDAIGFALTAPRGYADLSLWERFYLNGIENLNLKELNYWPPQDMDVHQRSLSLPAAGLLSQCRSLRKLFIHGTANEHFMSFFLKIPTLRDVQLREDYYPAPENDTTSEMRVDSCYRFQDALNRRHIPD
cccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccEEEECccccccccccccccccCEECcccccccccccccccccHHHHHHHHHHHcccccEEEcccccHHHHHHHHcccccccEEEEEcccccccccccccHHHHHcccccccCECcccccccccccHHHHHHcccccccccEEEccccccccccccHHHHHHHHHccccccEEEccccccccccccccHHHHHHHHHccccccEEEEccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHcccccccEEEccccccccccccccHHHHHHHccccccEEECcccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHcHHHHHHHHcccccccccccccccccccccccccHHHHHcccccHHHHHccccccccccEEEEEEEcccccccccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHcccccc
********VPNFHDILPDAIMSNIFSLITDTRTRNAMSLVCLKWCKLERSTRKSLALRGNIRDLNQVPVCFQAINNLDLSCLSPWGHPLLESSSNPSLLAKLLSHAFPSVVSLTIYARSPLTLHFLAPEWPKLSHVKLVRWHQRFNAPIGYDFFALFEHCPSLSSIDLSHFYCWTEDLPTAFELYPSIAASLSHLNLLVGHSFTEGYKSHELLSITSACPNLSQLLATCVFDHRFLGFVGDETLLSIASNCPRLSLLHLADSTALSSNSSRADPNNNDEGYASEDARISPTALGDFFESLPLLEELVLDVGNNVRDTWPALELLNSKCPRLKSLKLGQVHGICREIDSSMPAAGVALWKGLESLSIKNSADLTDSALIAISLGCSNLTKFEVQGCNKITKMGMQIFARVLEKTLVDVRISSCKYLNTVCSLQALEPIRDRIQRLHVDCVWESVEQYSQDHEI*********EACGFKDFQTEKRIMMSEEEASLKKKAKCCDGSGNGFSSCSDTWTKLKYLSLWIAVGELLNPIRLAGLENCPILEEIQIKVVGDCRNQQKPVFMAEFGLNSLVNYPQLSRMHFDCGDAIGFALTAPRGYADLSLWERFYLNGIENLNLKELNYWPPQDMDVHQRSLSLPAAGLLSQCRSLRKLFIHGTANEHFMSFFLKIPTLRDVQLREDYYPAPENDTTSEMRVDSCYRFQDALNRR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATTVSKVPNFHDILPDAIMSNIFSLITDTRTRNAMSLVCLKWCKLERSTRKSLALRGNIRDLNQVPVCFQAINNLDLSCLSPWGHPLLESSSNPSLLAKLLSHAFPSVVSLTIYARSPLTLHFLAPEWPKLSHVKLVRWHQRFNAPIGYDFFALFEHCPSLSSIDLSHFYCWTEDLPTAFELYPSIAASLSHLNLLVGHSFTEGYKSHELLSITSACPNLSQLLATCVFDHRFLGFVGDETLLSIASNCPRLSLLHLADSTALSSNSSRADPNNNDEGYASEDARISPTALGDFFESLPLLEELVLDVGNNVRDTWPALELLNSKCPRLKSLKLGQVHGICREIDSSMPAAGVALWKGLESLSIKNSADLTDSALIAISLGCSNLTKFEVQGCNKITKMGMQIFARVLEKTLVDVRISSCKYLNTVCSLQALEPIRDRIQRLHVDCVWESVEQYSQDHEIRGESSSSSHEACGFKDFQTEKRIMMSEEEASLKKKAKCCDGSGNGFSSCSDTWTKLKYLSLWIAVGELLNPIRLAGLENCPILEEIQIKVVGDCRNQQKPVFMAEFGLNSLVNYPQLSRMHFDCGDAIGFALTAPRGYADLSLWERFYLNGIENLNLKELNYWPPQDMDVHQRSLSLPAAGLLSQCRSLRKLFIHGTANEHFMSFFLKIPTLRDVQLREDYYPAPENDTTSEMRVDSCYRFQDALNRRHIPD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box protein ORE9 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes the senescence. Contributes to the selective repression of axillary shoots and moderates the branching by regulating negatively the auxin transport in primary stems, in an AXR1-independent manner.probableQ9SIM9
F-box/LRR-repeat MAX2 homolog Controls tillering by suppressing axillary bud activity. Tiller is a specialized grain-bearing branch that is formed on the unelongated basal internode and grows independently of the mother stem (culm) by means of its own adventitious roots. May be involved in the ubiquitin-mediated degradation of specific proteins that activate axillary growth.probableQ5VMP0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 14-271,292-453
View the alignment between query and template
View the model in PyMOL
Template: 3OGK, chain B
Confidence level:very confident
Coverage over the Query: 100-265,291-460,513-613,633-680
View the alignment between query and template
View the model in PyMOL
Template: 2P1M, chain B
Confidence level:very confident
Coverage over the Query: 17-460,513-590
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:confident
Coverage over the Query: 63-487,504-613,633-683
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:confident
Coverage over the Query: 63-458,473-493,511-658
View the alignment between query and template
View the model in PyMOL