Citrus Sinensis ID: 044178

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MELQFPSFILISSLLLFLFKVAKILQQSLATKSTSQKLPPGPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH
ccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHccEEEEEcccEEEEEEEcHHHHHHHHHHcccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHccHHHHcccccccccHHHHHHHHcHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccccccccccccEEccEEcccccEEEEEEEEEcccccccccccccccccccccccccccccccEEccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccEEcccccEEEEEccc
cccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEcccEcHHHcccccHHHHHHHHHHHHccEEEEEEcccEEEEEccHHHHHHHHccccccccEEcccHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHcHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccEEcHHHHHccHHHHHHHHHHHHcccccccccccHccccEEEccEEcccccEEEEEEEEEcccccccccHHHccHHHHcccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEccccEEEEEccc
MELQFPSFILISSLLLFLFKVAKILQQSLatkstsqklppgpwrlpligNLHQLVASlphhslrdltqkhgplmhlklgEVSTIVVSSQEIAKEVLKTHDlvfaqrpllvsakftsydytniglapygsyWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIfvagsdtssTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETlrlhppaplllpresresceingyaipentRIIVNAWaigrdpsywseaealyperflnssidyrgkdfeyipfgagrricpgitfaipnielPLAQLLFHfdwklpngmkqdhldMSEVFGLtirrkndlllipvph
MELQFPSFILISSLLLFLFKVAKILQQSLatkstsqklppgPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELlstkrvqsfrsireeevsnliktdifvagsdtsSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHppaplllpresrESCEINgyaipentrIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLtirrkndlllipvph
MELQFPsfilisslllflfKVAKILQQSLATKSTSQKLPPGPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETlrlhppaplllprESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH
****FPSFILISSLLLFLFKVAKILQQSLA**********GPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLI****
MELQFPSFILISSLLLFLFKVAKI*******************RLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH
MELQFPSFILISSLLLFLFKVAKILQQSLATKSTSQKLPPGPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH
*ELQFPSFILISSLLLFLFKVAKILQQSLATKSTSQKLPPGPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELQFPSFILISSLLLFLFKVAKILQQSLATKSTSQKLPPGPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query366 2.2.26 [Sep-21-2011]
O48923510 Cytochrome P450 71D10 OS= no no 0.603 0.433 0.636 1e-86
A6YIH8502 Premnaspirodiene oxygenas N/A no 0.549 0.400 0.597 4e-75
P93531500 Cytochrome P450 71D7 OS=S N/A no 0.612 0.448 0.559 1e-73
Q94FM7504 5-epiaristolochene 1,3-di N/A no 0.551 0.400 0.574 2e-71
O81974504 Cytochrome P450 71D8 OS=G no no 0.540 0.392 0.592 2e-71
Q6WKY9497 Cytochrome P450 71D95 OS= N/A no 0.598 0.440 0.542 5e-71
P93530501 Cytochrome P450 71D6 OS=S N/A no 0.612 0.447 0.533 5e-70
D5JBX1496 Germacrene A oxidase OS=B N/A no 0.527 0.389 0.552 7e-70
Q6IV13496 Cytochrome P450 71D95 OS= N/A no 0.592 0.437 0.542 8e-70
Q9XHE7500 Cytochrome P450 71D13 OS= N/A no 0.598 0.438 0.533 8e-70
>sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 Back     alignment and function desciption
 Score =  320 bits (819), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 142/223 (63%), Positives = 182/223 (81%), Gaps = 2/223 (0%)

Query: 142 LLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVR 201
           LL  ++   FR + ++ +  +I+ DIF+ G +TSS+ VEW M+E+++NPR+++EAQAEVR
Sbjct: 286 LLKFQKESEFR-LTDDNIKAVIQ-DIFIGGGETSSSVVEWGMSELIRNPRVMEEAQAEVR 343

Query: 202 RVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRII 261
           RV+  K  V+E  +H+L +LK ++KET+RLHPP PLL+PR SRE C+INGY IP  TRII
Sbjct: 344 RVYDSKGYVDETELHQLIYLKSIIKETMRLHPPVPLLVPRVSRERCQINGYEIPSKTRII 403

Query: 262 VNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIEL 321
           +NAWAIGR+P YW E E+  PERFLNSSID+RG DFE+IPFGAGRRICPGITFAIPNIEL
Sbjct: 404 INAWAIGRNPKYWGETESFKPERFLNSSIDFRGTDFEFIPFGAGRRICPGITFAIPNIEL 463

Query: 322 PLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPV 364
           PLAQLL+HFDWKLPN MK + LDM+E  G+T+RR+NDL LIP+
Sbjct: 464 PLAQLLYHFDWKLPNKMKNEELDMTESNGITLRRQNDLCLIPI 506

Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 Back     alignment and function description
>sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 Back     alignment and function description
>sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 Back     alignment and function description
>sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 Back     alignment and function description
>sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 Back     alignment and function description
>sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 Back     alignment and function description
>sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 Back     alignment and function description
>sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 Back     alignment and function description
>sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
296089886 1345 unnamed protein product [Vitis vinifera] 0.972 0.264 0.521 1e-111
255580182438 cytochrome P450, putative [Ricinus commu 0.928 0.776 0.481 2e-97
357494819376 Cytochrome P450 [Medicago truncatula] gi 0.937 0.912 0.493 6e-97
222625310443 hypothetical protein OsJ_11620 [Oryza sa 0.975 0.805 0.422 3e-96
356540718456 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.918 0.736 0.453 2e-91
356520110420 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.885 0.771 0.483 9e-91
297733668416 unnamed protein product [Vitis vinifera] 0.901 0.793 0.460 2e-85
351720812 510 cytochrome P450 71D10 [Glycine max] gi|5 0.603 0.433 0.636 9e-85
359494295 554 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.546 0.361 0.701 4e-84
296089885275 unnamed protein product [Vitis vinifera] 0.549 0.730 0.701 2e-83
>gi|296089886|emb|CBI39705.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/389 (52%), Positives = 270/389 (69%), Gaps = 33/389 (8%)

Query: 8   FILISSLLLFLFKVAKILQQSLATKSTSQKLPPGPWRLPLIGNLHQLVASLPHHSLRDLT 67
           F+    L L + KV  ++Q  +   S +     GPW+LP+IGN+HQLV SLPHHSLR+L 
Sbjct: 358 FLAKKYLHLRISKVGYVIQSCV---SPNPSFYFGPWKLPIIGNMHQLVGSLPHHSLRNLA 414

Query: 68  QKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAKFTSYDYTNI----- 122
           +KHGPLMHL+LGEVS IVVSS+E+AKEV+KTHD++F+QRP +++A      + ++     
Sbjct: 415 KKHGPLMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQRPCILAASIRVQSFRSVREEEV 474

Query: 123 -------------GLAPYGSYWRQLRRICTVELLSTK---------RVQSFRSIREEEVS 160
                          A  G  +       +++LL            +VQ    +     +
Sbjct: 475 LNLDQEAFSVTLEKFAGSGGGFTIADVFPSIKLLHVVNEDLVDVLLKVQKQGDLEFPLTT 534

Query: 161 NLIKT---DIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHE 217
           + IK    D+F+AGS+TSST+VEWAMAEMLKNP ++ +AQAEVR +F  K N +E  IHE
Sbjct: 535 DNIKAILLDLFIAGSETSSTAVEWAMAEMLKNPGVMAKAQAEVRDIFSRKGNADETMIHE 594

Query: 218 LKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEA 277
           LKFLKLV+KETLRLHPP PLL+PRESRESCEINGY IP  TR+I+NAWA+ RDP +W++A
Sbjct: 595 LKFLKLVIKETLRLHPPVPLLIPRESRESCEINGYEIPVKTRVIINAWAVARDPEHWNDA 654

Query: 278 EALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNG 337
           E+  PERFL+SSIDY+G +FEYIPFGAGRR+CPGI F + N+E+ LAQLL++FDWKLPNG
Sbjct: 655 ESFNPERFLDSSIDYQGTNFEYIPFGAGRRMCPGILFGMANVEIALAQLLYYFDWKLPNG 714

Query: 338 MKQDHLDMSEVFGLTIRRKNDLLLIPVPH 366
            + + LDM+E F  ++RRK +L LIP+ +
Sbjct: 715 TQHEELDMTEDFRTSLRRKLNLHLIPITY 743

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255580182|ref|XP_002530922.1| cytochrome P450, putative [Ricinus communis] gi|223529516|gb|EEF31471.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357494819|ref|XP_003617698.1| Cytochrome P450 [Medicago truncatula] gi|355519033|gb|AET00657.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|222625310|gb|EEE59442.1| hypothetical protein OsJ_11620 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|356540718|ref|XP_003538832.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D8-like [Glycine max] Back     alignment and taxonomy information
>gi|356520110|ref|XP_003528708.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D8-like [Glycine max] Back     alignment and taxonomy information
>gi|297733668|emb|CBI14915.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351720812|ref|NP_001236165.1| cytochrome P450 71D10 [Glycine max] gi|5915839|sp|O48923.1|C71DA_SOYBN RecName: Full=Cytochrome P450 71D10 gi|2739000|gb|AAB94588.1| CYP71D10p [Glycine max] Back     alignment and taxonomy information
>gi|359494295|ref|XP_003634756.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D10-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089885|emb|CBI39704.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
UNIPROTKB|Q9XHE8496 CYP71D18 "Cytochrome P450 71D1 0.590 0.435 0.495 3.1e-87
UNIPROTKB|Q9XHE7500 CYP71D13 "Cytochrome P450 71D1 0.598 0.438 0.497 8.1e-87
UNIPROTKB|Q9XHE6498 CYP71D15 "Cytochrome P450 71D1 0.598 0.439 0.479 1e-84
UNIPROTKB|Q0JF01502 CYP99A3 "9-beta-pimara-7,15-di 0.549 0.400 0.450 2.2e-84
TAIR|locus:2079251500 CYP71B34 ""cytochrome P450, fa 0.549 0.402 0.472 2.5e-83
TAIR|locus:2179290496 CYP71B13 ""cytochrome P450, fa 0.551 0.407 0.480 2.2e-82
UNIPROTKB|A3A871515 CYP71Z6 "Ent-isokaurene C2-hyd 0.573 0.407 0.452 9.4e-82
UNIPROTKB|Q6YV88518 CYP71Z7 "Ent-cassadiene C2-hyd 0.568 0.401 0.437 1.5e-81
TAIR|locus:2093531501 CYP71B23 ""cytochrome P450, fa 0.579 0.423 0.437 3.2e-81
TAIR|locus:2179270496 CYP71B11 ""ytochrome p450, fam 0.543 0.401 0.457 2.2e-80
UNIPROTKB|Q9XHE8 CYP71D18 "Cytochrome P450 71D18" [Mentha spicata (taxid:29719)] Back     alignment and assigned GO terms
 Score = 569 (205.4 bits), Expect = 3.1e-87, Sum P(2) = 3.1e-87
 Identities = 109/220 (49%), Positives = 146/220 (66%)

Query:   147 RVQSFRSIREEEVSNLIKT---DIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRV 203
             R+Q    I+    SN IK    D F AG++TSST++ WA++E+++NP  + + QAEVR  
Sbjct:   272 RMQKGSDIKIPITSNCIKGFIFDTFSAGAETSSTTISWALSELMRNPAKMAKVQAEVREA 331

Query:   204 FKGKENVNEAAIHELKFLKLVVKETXXXXXXXXXXXXXESRESCEINGYAIPENTRIIVN 263
              KGK  V+ + + ELK+L+ V+KET             +SRE CE+NGY IP  TRI +N
Sbjct:   332 LKGKTVVDLSEVQELKYLRSVLKETLRLHPPFPLIPR-QSREECEVNGYTIPAKTRIFIN 390

Query:   264 AWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPL 323
              WAIGRDP YW + +   PERF   S D+ G DFE+IPFGAGRRICPG+ F + N+E+PL
Sbjct:   391 VWAIGRDPQYWEDPDTFRPERFDEVSRDFMGNDFEFIPFGAGRRICPGLHFGLANVEIPL 450

Query:   324 AQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIP 363
             AQLL+HFDWKLP GM    LDM+E  GL+  +K ++ L+P
Sbjct:   451 AQLLYHFDWKLPQGMTDADLDMTETPGLSGPKKKNVCLVP 490
GO:0018675 "(S)-limonene 6-monooxygenase activity" evidence=IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
GO:0055114 "oxidation-reduction process" evidence=IDA
UNIPROTKB|Q9XHE7 CYP71D13 "Cytochrome P450 71D13" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XHE6 CYP71D15 "Cytochrome P450 71D15" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
UNIPROTKB|Q0JF01 CYP99A3 "9-beta-pimara-7,15-diene oxidase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179290 CYP71B13 ""cytochrome P450, family 71, subfamily B, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A3A871 CYP71Z6 "Ent-isokaurene C2-hydroxylase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YV88 CYP71Z7 "Ent-cassadiene C2-hydroxylase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179270 CYP71B11 ""ytochrome p450, family 71, subfamily B, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
BRADI3G15020.1
annotation not avaliable (386 aa)
(Brachypodium distachyon)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-72
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 5e-71
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-66
pfam00067461 pfam00067, p450, Cytochrome P450 2e-58
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 2e-56
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-55
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-52
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-48
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 2e-37
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-36
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 8e-36
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-35
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 5e-34
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 1e-33
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 4e-32
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-32
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-29
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 3e-26
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-25
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-24
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-22
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 2e-22
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 4e-19
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 6e-19
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 2e-18
pfam00067 461 pfam00067, p450, Cytochrome P450 8e-18
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 1e-16
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 4e-15
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 5e-15
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-14
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 1e-13
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-13
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 6e-13
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 2e-12
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 4e-10
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 6e-10
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 7e-10
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 1e-08
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-05
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score =  233 bits (596), Expect = 2e-72
 Identities = 97/217 (44%), Positives = 144/217 (66%), Gaps = 5/217 (2%)

Query: 153 SIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNE 212
            I + E+  L+  ++F AG+DT+S++VEWA+AE++++P ILK+AQ E+  V      V+E
Sbjct: 292 RITDTEIKALL-LNLFTAGTDTTSSTVEWAIAELIRHPDILKKAQEELDAVVGRDRLVSE 350

Query: 213 AAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPS 272
           + + +L +L+ V+KET RLHP  PL LPR + E CEINGY IP+   ++VN WAI RDP 
Sbjct: 351 SDLPQLTYLQAVIKETFRLHPSTPLSLPRMAAEECEINGYHIPKGATLLVNVWAIARDPE 410

Query: 273 YWSEAEALYPERFL----NSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLF 328
            W +     P+RFL    ++ +D +G DFE IPFGAGRRIC G+++ +  + L  A L+ 
Sbjct: 411 QWPDPLEFRPDRFLPGGEHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLLTATLVH 470

Query: 329 HFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVP 365
            FDW+L +G   D L+M E +GLT++R   L++ P P
Sbjct: 471 AFDWELADGQTPDKLNMEEAYGLTLQRAVPLMVHPRP 507

Length = 517
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 366
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02648480 allene oxide synthase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.7e-72  Score=516.69  Aligned_cols=324  Identities=53%  Similarity=0.923  Sum_probs=287.3

Q ss_pred             CCCCCCCCCCcceeeccccCCCC-chHHHHHHHHhcCCeeEEecCCeeEEEeCCHHHHHHHHhhCCcccCCCCc-ccccc
Q 044178           36 QKLPPGPWRLPLIGNLHQLVASL-PHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPL-LVSAK  113 (366)
Q Consensus        36 ~~~ppgp~~~P~lG~~~~~~~~~-~~~~~~~~~~kyG~i~~~~~~~~~~vvv~~~~~v~~il~~~~~~~~~~~~-~~~~~  113 (366)
                      .++||||+++|+|||++++ ... +|..+.++.++|||+|++|+|..++|||+|++.++|++.+++..|++|+. .....
T Consensus        25 ~~lPPGP~~lPiIGnl~~l-~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQL-GSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCcCCCCCCccccHHHc-CCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            8899999999999999999 555 99999999999999999999999999999999999999999999999997 33445


Q ss_pred             hhccCCCceEecCCChhHHHHHHHHHhhhcchhhhhhhhhhHHHHHHHHHhh----------------------------
Q 044178          114 FTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKT----------------------------  165 (366)
Q Consensus       114 ~~~~~~~~~~~~~~~~~w~~~R~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~----------------------------  165 (366)
                      ...+++.++.++++|+.|+.+||+....+++.+..+++...-.++++.+++.                            
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI~~~~  183 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVICRML  183 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHHHHHH
Confidence            6666789999999999999999998787777776555443333333332211                            


Q ss_pred             --------------------------------------------------------------------------------
Q 044178          166 --------------------------------------------------------------------------------  165 (366)
Q Consensus       166 --------------------------------------------------------------------------------  165 (366)
                                                                                                      
T Consensus       184 fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~~~~~  263 (489)
T KOG0156|consen  184 FGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKIGDEEG  263 (489)
T ss_pred             hCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCC
Confidence                                                                                            


Q ss_pred             -----------------------------hhhhccccchHHHHHHHHHHHhhCHHHHHHHHHHHHHHhcCCCCCCHHHhh
Q 044178          166 -----------------------------DIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIH  216 (366)
Q Consensus       166 -----------------------------~~~~ag~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~~~~~~~~~~~~l~  216 (366)
                                                   ++++||.|||+.++.|++.+|.+||++|+|+++||++++|.++.++.+|+.
T Consensus       264 ~D~vD~lL~~~~~~~~~~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~~r~v~e~D~~  343 (489)
T KOG0156|consen  264 RDFVDALLKLMKEEKAEGLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVGKGRLVSESDLP  343 (489)
T ss_pred             CcHHHHHHHhhcccccCCCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCChhhhc
Confidence                                         789999999999999999999999999999999999999998889999999


Q ss_pred             cChhHHHHHHHHhccCCCCCCCCcccccCCceecceeeCCCCEEeecchhhhcCCCCCCCCCCcCCCCCCCCCCCCCCCC
Q 044178          217 ELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKD  296 (366)
Q Consensus       217 ~l~~l~a~i~E~lRl~~~~~~~~~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~P~R~l~~~~~~~~~~  296 (366)
                      ++|||+|+|+|++|++|++|..+||.+.+|+.++||.|||||.|.++.+++||||++|+||++|+||||++++ +.....
T Consensus       344 ~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~~-d~~~~~  422 (489)
T KOG0156|consen  344 KLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDSN-DGKGLD  422 (489)
T ss_pred             cCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCCc-cccCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999975 222366


Q ss_pred             CcccccCCCCCCCccHHHHHHHHHHHHHHHHHhceeecCCCCCCCCCCcccccceeeecCCceEEeeecC
Q 044178          297 FEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH  366 (366)
Q Consensus       297 ~~~~~Fg~G~r~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~  366 (366)
                      ..++|||.|+|.|||..+|.+|+.++++.++++|||+++++    +++..+.. +++..+.++.+.+.+|
T Consensus       423 ~~~iPFG~GRR~CpG~~La~~~l~l~la~llq~F~w~~~~~----~~d~~e~~-~~~~~~~pl~~~~~~r  487 (489)
T KOG0156|consen  423 FKLIPFGSGRRICPGEGLARAELFLFLANLLQRFDWKLPGG----KVDMEEAG-LTLKKKKPLKAVPVPR  487 (489)
T ss_pred             eEecCCCCCcCCCCcHHHHHHHHHHHHHHHHheeeeecCCC----CCCCcccc-cceecCCcceeeeecC
Confidence            78999999999999999999999999999999999999877    34555663 7777777887777765

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 9e-21
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 9e-21
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 9e-21
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 3e-20
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 9e-19
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-16
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-15
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-15
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 3e-15
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-15
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 3e-14
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 1e-13
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 4e-12
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 8e-12
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 1e-11
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 1e-11
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-11
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-11
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-11
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 2e-11
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-11
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-11
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 2e-11
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-11
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-11
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-11
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 7e-11
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 7e-11
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 7e-11
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 7e-11
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 7e-11
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 7e-11
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 7e-11
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-11
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 7e-11
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 7e-11
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 8e-11
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 8e-11
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 9e-11
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 9e-11
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 1e-10
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-10
3pm0_A507 Structural Characterization Of The Complex Between 1e-10
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-10
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 2e-10
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-10
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 2e-10
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 2e-10
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 2e-10
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-10
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-10
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-10
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 2e-10
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 2e-10
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-10
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-10
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-10
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 2e-10
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 3e-10
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-10
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 3e-10
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 3e-10
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 3e-10
1fah_A471 Structure Of Cytochrome P450 Length = 471 3e-10
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 3e-10
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 3e-10
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-10
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 5e-10
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 5e-10
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 8e-10
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 8e-10
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 8e-10
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 8e-10
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-09
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 3e-09
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 4e-09
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 1e-08
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 1e-08
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 1e-08
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 1e-08
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 1e-08
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 1e-08
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 2e-07
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 2e-07
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 3e-07
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 5e-07
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 1e-04
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 7e-04
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 7e-04
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 7e-04
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure 
Iteration: 1

 Score = 97.8 bits (242), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 106/191 (55%), Gaps = 5/191 (2%)
Query: 144 STKRVQSFRSIREEEVSNLIKTDIFV-AGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRR 202
           ++K  +S +++ + E+  + ++ IF+ AG +T+S+ + + M E+  +P + ++ Q E+  
Sbjct: 260 NSKETESHKALSDLEL--VAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDA 317
Query: 203 VFKGKENVNEAAIHELKFLKLVVKETXXXXXXXXXXXXXESRESCEINGYAIPENTRIIV 262
           V   K       + ++++L +VV ET               ++  EING  IP+   +++
Sbjct: 318 VLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERV-CKKDVEINGMFIPKGVVVMI 376
Query: 263 NAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELP 322
            ++A+ RDP YW+E E   PERF   + D     + Y PFG+G R C G+ FA+ N++L 
Sbjct: 377 PSYALHRDPKYWTEPEKFLPERFSKKNKD-NIDPYIYTPFGSGPRNCIGMRFALMNMKLA 435
Query: 323 LAQLLFHFDWK 333
           L ++L +F +K
Sbjct: 436 LIRVLQNFSFK 446
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-89
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-45
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 6e-82
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-36
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-81
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-39
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-79
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-34
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 7e-63
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-18
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-60
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 5e-19
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 9e-51
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 8e-15
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-49
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-17
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-49
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 9e-09
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-48
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-16
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-46
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 9e-12
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 5e-46
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 1e-08
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-45
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-04
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-44
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 5e-09
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-42
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-24
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-41
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 5e-12
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 6e-39
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-36
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-24
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-36
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-24
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 5e-36
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 9e-25
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-35
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-25
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-35
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 9e-27
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 7e-35
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-33
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-33
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 9e-33
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-23
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-32
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 4e-22
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 3e-32
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-22
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 9e-32
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-22
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 2e-05
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 2e-05
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 2e-05
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-05
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 2e-05
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 3e-05
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 3e-05
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 3e-05
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 3e-05
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 4e-05
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 4e-05
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 6e-05
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 7e-05
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 8e-05
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 1e-04
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 1e-04
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 1e-04
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-04
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 2e-04
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 3e-04
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 3e-04
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 3e-04
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 3e-04
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 4e-04
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 5e-04
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 5e-04
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 6e-04
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 6e-04
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 8e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score =  276 bits (708), Expect = 2e-89
 Identities = 53/201 (26%), Positives = 92/201 (45%), Gaps = 8/201 (3%)

Query: 165 TDIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIHELKFLKLV 224
           T++   G DT+S +++W + EM +N ++    +AEV       +      +  +  LK  
Sbjct: 281 TEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKAS 340

Query: 225 VKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPER 284
           +KETLRLHP +   L R       +  Y IP  T + V  +A+GR+P+++ + E   P R
Sbjct: 341 IKETLRLHPISV-TLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTR 399

Query: 285 FLNSSIDYRGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLD 344
           +L+   D     F  + FG G R C G   A   + + L  +L +F  ++ +       D
Sbjct: 400 WLSK--DKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLS-----D 452

Query: 345 MSEVFGLTIRRKNDLLLIPVP 365
           +   F L +  +  +     P
Sbjct: 453 VGTTFNLILMPEKPISFTFWP 473
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-71  Score=522.82  Aligned_cols=328  Identities=27%  Similarity=0.455  Sum_probs=271.5

Q ss_pred             CCCCCCCCCCCCcceeeccccCCCCchHHHHHHHHhcCCeeEEecCCeeEEEeCCHHHHHHHHhhCCcccCCCCcccccc
Q 044178           34 TSQKLPPGPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDLVFAQRPLLVSAK  113 (366)
Q Consensus        34 ~~~~~ppgp~~~P~lG~~~~~~~~~~~~~~~~~~~kyG~i~~~~~~~~~~vvv~~~~~v~~il~~~~~~~~~~~~~~~~~  113 (366)
                      +..++||||+++|+|||++++..++++..+.+|++||||||++++|++++|+|+||+++++++.+++..|++++......
T Consensus         7 s~~kLPPGP~~lP~iGn~~~~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~~~~~~   86 (479)
T 3tbg_A            7 SKGKLPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQ   86 (479)
T ss_dssp             --CCCCCCSCCBTTTBTGGGCCTTSHHHHHHHHHHHHCSEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCCCGGGG
T ss_pred             CCCCCCCCCCCcCcccchHhhcCCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCchHHHH
Confidence            33478999999999999999966789999999999999999999999999999999999999998888898887665554


Q ss_pred             hhccC--CCceEecCCChhHHHHHHHHHhhhcchhhhhh--hhhhHHHHHHHHHhh------------------------
Q 044178          114 FTSYD--YTNIGLAPYGSYWRQLRRICTVELLSTKRVQS--FRSIREEEVSNLIKT------------------------  165 (366)
Q Consensus       114 ~~~~~--~~~~~~~~~~~~w~~~R~~l~~~~~~~~~~~~--~~~~~~~~~~~l~~~------------------------  165 (366)
                      ....+  +.++.+..+|+.|+++|+.+ .+.|+...+..  +...+......+...                        
T Consensus        87 ~~~~~~~~~~~~~~~~g~~w~~~R~~~-~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (479)
T 3tbg_A           87 ILGFGPRSQGVFLARYGPAWREQRRFS-VSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIA  165 (479)
T ss_dssp             GGTCBTTBCCSTTCCSSHHHHHHHHHH-HHHHHHTTSTTCHHHHHHHHHHHHHHHHHHTTTTCCBCTHHHHHHHHHHHHH
T ss_pred             HhccCCCCCceeeCCCCHHHHHHHHHH-HHHhcchhhhHHHHHHHHHHHHHHHHHHHHhccCCcccHHHHHHHHHHHHHH
Confidence            43332  34455667799999999997 44443322211  111111111111110                        


Q ss_pred             --------------------------------------------------------------------------------
Q 044178          166 --------------------------------------------------------------------------------  165 (366)
Q Consensus       166 --------------------------------------------------------------------------------  165 (366)
                                                                                                      
T Consensus       166 ~~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (479)
T 3tbg_A          166 SLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQP  245 (479)
T ss_dssp             HHHHSCCCCTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHSGGGGGSHHHHHHHTHHHHHHHHHHHHHHHHHHHHCCTTSC
T ss_pred             HhhcCCcccccchhhhhhhhhhhhhhhhhhhhhhhhhcccchhccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhcccc
Confidence                                                                                            


Q ss_pred             ---------------------------------hhhhccccchHHHHHHHHHHHhhCHHHHHHHHHHHHHHhcCCCCCCH
Q 044178          166 ---------------------------------DIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNE  212 (366)
Q Consensus       166 ---------------------------------~~~~ag~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~~~~~~~~~~  212 (366)
                                                       ++++||+|||+.+++|++++|++||++|+|+++|++.+++.++.++.
T Consensus       246 ~~d~~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~  325 (479)
T 3tbg_A          246 PRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM  325 (479)
T ss_dssp             CCSHHHHHHHHHHHTTTCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCH
T ss_pred             cchhhhhhhhhhhhcccCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccch
Confidence                                             67899999999999999999999999999999999999998889999


Q ss_pred             HHhhcChhHHHHHHHHhccCCCCCCCCcccccCCceecceeeCCCCEEeecchhhhcCCCCCCCCCCcCCCCCCCCCCCC
Q 044178          213 AAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDY  292 (366)
Q Consensus       213 ~~l~~l~~l~a~i~E~lRl~~~~~~~~~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~P~R~l~~~~~~  292 (366)
                      +++++||||+||++|+||++|+++...+|.+.+|++++||.||+||.|.++.+++||||++|+||++|+||||++++++ 
T Consensus       326 ~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~-  404 (479)
T 3tbg_A          326 GDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGH-  404 (479)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCC-
T ss_pred             hhhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcc-
Confidence            9999999999999999999999999987788999999999999999999999999999999999999999999987765 


Q ss_pred             CCCCCcccccCCCCCCCccHHHHHHHHHHHHHHHHHhceeecCCCCCCCCCCcccccceeeecCCceEEeeecC
Q 044178          293 RGKDFEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH  366 (366)
Q Consensus       293 ~~~~~~~~~Fg~G~r~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~  366 (366)
                      ..++++|+|||+|+|+|+|++||.+|+++++++||++|||+++++.+  ........++++.|+ +++++++||
T Consensus       405 ~~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~--~~~~~~~~~~~~~P~-~~~v~~~pR  475 (479)
T 3tbg_A          405 FVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQP--RPSHHGVFAFLVSPS-PYELCAVPR  475 (479)
T ss_dssp             BCCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTSC--CCCSCEEESSSEEEC-CCCBEEEEC
T ss_pred             cCCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCCC--CccccccceeeecCC-CeEEEEEEC
Confidence            34567899999999999999999999999999999999999988754  233334456677776 555555554
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 366
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-40
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 9e-27
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-38
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 7e-20
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-37
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-27
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 4e-31
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-29
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-24
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 9e-24
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 3e-22
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-21
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-16
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-12
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 5e-16
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-10
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-15
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 3e-14
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-11
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 4e-14
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 7e-14
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-13
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 3e-12
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 3e-11
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 7e-06
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 3e-11
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-10
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-10
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 9e-10
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 2e-09
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 4e-09
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  145 bits (366), Expect = 3e-40
 Identities = 55/232 (23%), Positives = 99/232 (42%), Gaps = 4/232 (1%)

Query: 131 WRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKTDIFVAGSDTSSTSVEWAMAEMLKNP 190
                 +        +      S   +E       ++ +AG++T++  + WA+  M   P
Sbjct: 232 QLPQHFVDAYLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYP 291

Query: 191 RILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEIN 250
            I  + Q E+  +       +     ++ + + V+ E LR     PL +   + E   + 
Sbjct: 292 NIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVR 351

Query: 251 GYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICP 310
           GY+IP+ T +I N +++  D  YW + E  +PERFL+SS  +  K    +PF  GRR C 
Sbjct: 352 GYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFA-KKEALVPFSLGRRHCL 410

Query: 311 GITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLI 362
           G   A   + L    LL  F    P+ +     D+    G+T++ +  L+  
Sbjct: 411 GEHLARMEMFLFFTALLQRFHLHFPHELV---PDLKPRLGMTLQPQPYLICA 459
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8e-67  Score=489.36  Aligned_cols=317  Identities=26%  Similarity=0.466  Sum_probs=278.3

Q ss_pred             CCCCCCCcceeeccccCCCCchHHHHHHHHhcCCeeEEecCCeeEEEeCCHHHHHHHHhhCCc-ccCCCCcccccchhcc
Q 044178           39 PPGPWRLPLIGNLHQLVASLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKEVLKTHDL-VFAQRPLLVSAKFTSY  117 (366)
Q Consensus        39 ppgp~~~P~lG~~~~~~~~~~~~~~~~~~~kyG~i~~~~~~~~~~vvv~~~~~v~~il~~~~~-~~~~~~~~~~~~~~~~  117 (366)
                      +|||+++|+|||++++ .++++.++.++++||||||+++++++++++|+||+.+++++.++.. .++.+.......   .
T Consensus        11 iPGP~~~P~iG~~~~~-~~~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~~~---~   86 (472)
T d1tqna_          11 IPGPTPLPFLGNILSY-HKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVG---F   86 (472)
T ss_dssp             CCCCCCBTTTBTGGGG-GGCHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSCCG---G
T ss_pred             CCCCCCcCceeEHHHh-hCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCccccccc---c
Confidence            4899999999999999 7889999999999999999999999999999999999999986654 344443332222   2


Q ss_pred             CCCceEecCCChhHHHHHHHHHhhhcchhhhhhhhhhHHHHHHHHHhh--------------------------------
Q 044178          118 DYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSIREEEVSNLIKT--------------------------------  165 (366)
Q Consensus       118 ~~~~~~~~~~~~~w~~~R~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~--------------------------------  165 (366)
                      .+.++.+ .+|+.|+++|+++ .+.|+.+.++.+.+.+.++++.+++.                                
T Consensus        87 ~~~~i~~-~~g~~~~~~R~~~-~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~dl~~~~~~~~~~v~~~~~~G~  164 (472)
T d1tqna_          87 MKSAISI-AEDEEWKRLRSLL-SPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGV  164 (472)
T ss_dssp             GGGSTTT-CCHHHHHHHHHHT-TGGGSHHHHHTTHHHHHHHHHHHHHHHHHHHHHSSCEEHHHHHHHHHHHHHHHTSSCC
T ss_pred             cCCceec-cCcHHHHHhhhhc-Cccccchhhhcccchhhhhhhcccccccccccccccchhhhhhhccchhhhhheeccc
Confidence            2344444 4699999999998 67788888888888777777666543                                


Q ss_pred             --------------------------------------------------------------------------------
Q 044178          166 --------------------------------------------------------------------------------  165 (366)
Q Consensus       166 --------------------------------------------------------------------------------  165 (366)
                                                                                                      
T Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  244 (472)
T d1tqna_         165 NIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDF  244 (472)
T ss_dssp             CCCGGGCTTCHHHHHHTTCCCCCTTSHHHHHHHHCGGGHHHHHHTTCCSSCHHHHHHHHHHHHHHHTTTTTTCSCCCCCH
T ss_pred             ccccccccchhhhHHHHHHhhhhhccchhcccccccccccccccccccccchhhhHHHHHHHHHhhhcccccccccccch
Confidence                                                                                            


Q ss_pred             -----------------------------hhhhccccchHHHHHHHHHHHhhCHHHHHHHHHHHHHHhcCCCCCCHHHhh
Q 044178          166 -----------------------------DIFVAGSDTSSTSVEWAMAEMLKNPRILKEAQAEVRRVFKGKENVNEAAIH  216 (366)
Q Consensus       166 -----------------------------~~~~ag~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~~~~~~~~~~~~l~  216 (366)
                                                   ++++||++||+.+++|++++|++||++|+++++||+++++.....+.+++.
T Consensus       245 ~~~~~~~~~~~~~~~~~~ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~  324 (472)
T d1tqna_         245 LQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVL  324 (472)
T ss_dssp             HHHHHHHHCC----CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHH
T ss_pred             hhhhhhcccccccccccchhhhHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccccccchHHHhh
Confidence                                         678999999999999999999999999999999999999988899999999


Q ss_pred             cChhHHHHHHHHhccCCCCCCCCcccccCCceecceeeCCCCEEeecchhhhcCCCCCCCCCCcCCCCCCCCCCCCCCCC
Q 044178          217 ELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKD  296 (366)
Q Consensus       217 ~l~~l~a~i~E~lRl~~~~~~~~~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~P~R~l~~~~~~~~~~  296 (366)
                      ++|||+||++|++|++|+++.. +|.+.+|+.++||.||||+.|+++.+++|+||++|+||++|+||||++++.+ ...+
T Consensus       325 ~~~~l~a~i~E~lRl~p~~~~~-~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~-~~~~  402 (472)
T d1tqna_         325 QMEYLDMVVNETLRLFPIAMRL-ERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKD-NIDP  402 (472)
T ss_dssp             HCHHHHHHHHHHHHHCCTTCCE-EEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGG-GCCT
T ss_pred             ccccccceeeeccccCCccccc-ccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcc-cCCC
Confidence            9999999999999999999876 7999999999999999999999999999999999999999999999987654 3356


Q ss_pred             CcccccCCCCCCCccHHHHHHHHHHHHHHHHHhceeecCCCCCCCCCCcccccceeeecCCceEEeeecC
Q 044178          297 FEYIPFGAGRRICPGITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVPH  366 (366)
Q Consensus       297 ~~~~~Fg~G~r~C~G~~~A~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~  366 (366)
                      ..|+|||+|+|+|+|++||.+|+++++++++++|||+++++.+   .+.....+.+++|+.+++++++||
T Consensus       403 ~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~---~~~~~~~~~~~~p~~~~~~~~~~R  469 (472)
T d1tqna_         403 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQ---IPLKLSLGGLLQPEKPVVLKVESR  469 (472)
T ss_dssp             TTSCTTCCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTTCC---SSCCBCSSSSCCBSSCCEEEEEET
T ss_pred             ceecCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCCCC---CCceeccceEEeeCCCEEEEEEEC
Confidence            7899999999999999999999999999999999999877643   445555677889999999999987
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure