Citrus Sinensis ID: 044280

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27

MQCQPEYSVSQVLTFFLLLAFKCSVVAPTQLNHQLSEPHWLPATATWYGSPEGDGSDGGACGYGSLVDVKPLRARVGAVSPVLFKNGGGCGACYKVRCLDKSICSRRAVTIIVTDECPGGYCSNGRTHFDLSGAAFGRMAIAGESGELRNRGELPVIYRRAPCKYPGKNIAFHVNEGSTDYWLSLLVEFEDGDGDVGSMHIREASSSEWLQMNHVWGANWSIIGGPLKGPFSVKLATLSTGRTLSARAVIPSNWSPKATYTSRLNFSP

cccccccHHHHHHHHHHHHHHHHHHHccccccccccccccCEEEEEEccccccccccccccccccccccccccccccccccHHcccccccccEEEEEEccccccccccEEEEEEccccccccccccccccccHHHHHHcccccccccHHccccccEEEEEcccccccccEEEEECcccccEEEEEEEEECcccccEEEEEEEEcccccEEEcccccccCEECccccccccEEEEEEEccccCEEEEccccccccccccEEEccccccc

********VSQVLTFFLLLAFKCSVVAPTQLNHQLSEPHWLPATATWYGSPEGDGSDGGACGYGSLVDVKPLRARVGAVSPVLFKNGGGCGACYKVRCLDKSICSRRAVTIIVTDECPGGYCSNGRTHFDLSGAAFGRMAIAGESGELRNRGELPVIYRRAPCKYPGKNIAFHVNEGSTDYWLSLLVEFEDGDGDVGSMHIREASSSEWLQMNHVWGANWSIIGGPLKGPFSVKLATLSTGRTLSARAVIPSNWSPKATYTSRLNFS*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Expansin-B3	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found.	confident	Q9M0I2
Expansin-B16	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence.	confident	Q0DZ85
Expansin-B17	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence.	probable	Q7X6J9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HCZ, chain X
Confidence level:very confident
Coverage over the Query: 25-266
View the alignment between query and template
View the model in PyMOL