Citrus Sinensis ID: 044292


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MSSSSENNSKKMIILKSSDGETFEVEETVALQSQTIRHMVEDDCADSVIPLPNVTGTILSMVVEYCKKHVEAAAAAAGGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADVIKDKSPEEVRRIFHINNDFTPQEEQEIRRENQWAFE
ccccccccccccEEEEcccccEEEEcHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHcccccc
***************KSSDGETFEVEETVALQSQTIRHMVEDDCADSVIPLPNVTGTILSMVVEYCKKHVEAAAAAAGGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADVIKDKSPEEVRRIFHINNDFTPQE****RRENQWAFE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSENNSKKMIILKSSDGETFEVEETVALQSQTIRHMVEDDCADSVIPLPNVTGTILSMVVEYCKKHVEAAAAAAGGDNDVKNWDRDFVKVDQETLLDLLLAANYLNIKDLLELTCQATADVIKDKSPEEVRRIFHINNDFTPQEEQEIRRENQWAFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SKP1-like protein 4 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends of the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1.probableQ9LNT9
SCF ubiquitin ligase complex protein SKP1a probableP52285
S-phase kinase-associated protein 1 Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(Cyclin F) directs ubiquitination of CP110.probableP63209

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1M, chain A
Confidence level:very confident
Coverage over the Query: 27-37,50-65,101-160
View the alignment between query and template
View the model in PyMOL