Citrus Sinensis ID: 044294

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-

MASRDSDYGAFMEKFVLQPSSSAHQLPLSGLTFAIKDIFDVDGHVTGFGNPDWARTHSAATSTAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPCAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHSAVSTAGVIPMAQSFDTVGWFAWDPKILNRVGRVLLQLADDVNLVRPSQVIFAEDCLQLSSIPSDRVTQGLVKSVEKLFGGHIIENVILGDYVKDKVPSLQHFLSEGNKEQEYSIPSLAALSSAMRLLQRYEFKNNHGDWVTTVKPDLGPGISERVWEAVRTSAQKIDVCQSVKTELRAALSALLGDHGILVIPTVPGPPPKLQMDPSALEVFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPVAISLLAKHGSDGFLLNLVETLHNTLKEELQRMS

cccccccccccccccccccccccccccccccCEEEEHcccccccccccccHHHccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHcccccHHHHHHccccEEEEccccHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccc

*ASRDSDYGAFMEKFVL*******QLPLSGLTFAIKDIFDVDGHVTGFGNPDWARTHSAATSTAPAVLAVLSGGATSIGKTIMDEMAYSINGENKHYGTPTNPCAPDRVPGGSS***AVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHSAVSTAGVIPMAQSFDTVGWFAWDPKILNRVGRVLLQLADDVNLVRPSQVIFAEDCLQLSSIPSDRVTQGLVKSVEKLFGGHIIENVILGDYVKDKVPSLQHFLSEGNKEQEYSIPSLAALSSAMRLLQRYEFKNNHGDWVTTVKPDLGPGISERVWEAVRTSAQKIDVCQSVKTELRAALSALLGDHGILVIPTVPGPPPKLQMDPSALEVFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPVAISLLAKHGSDGFLLNLVETLHNTLKE******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Amidase 1	Amidase involved in auxin biosynthesis. Converts indole-3-acetamide into indole-3-acetic acid. Can also use L-asparagine, oleamide and 1-naphtalene-acetamide as substrates, but not indole-3-acetonitrile or indole-3-acetyl-L-aspartic acid.	probable	Q9FR37

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KFU, chain E
Confidence level:very confident
Coverage over the Query: 1-257,276-409
View the alignment between query and template
View the model in PyMOL

Template: 3PPM, chain A
Confidence level:very confident
Coverage over the Query: 2-426
View the alignment between query and template
View the model in PyMOL