Citrus Sinensis ID: 044323

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MQTSPSRATRTFMDYGSISQAMDGICGLYERKLKELNPAIRDITYDVADLYNFIDGLADMSALVYDHSIQAYLPYDRQWIKQRTFQHLKKLAH
cccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHc
***********FMDYGSISQAMDGICGLYERKLKELNPAIRDITYDVADLYNFIDGLADMSALVYDHSIQAYLPYDRQWIKQRTFQHLKKL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTSPSRATRTFMDYGSISQAMDGICGLYERKLKELNPAIRDITYDVADLYNFIDGLADMSALVYDHSIQAYLPYDRQWIKQRTFQHLKKLAH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Enhancer of rudimentary homolog May have a role in the cell cycle.confidentQ96319
Enhancer of rudimentary homolog May have a role in the cell cycle.probableQ86A92
Protein enhancer of rudimentary Acts as an enhancer of the rudimentary gene. Has a role in pyrimidine biosynthesis and the cell cycle.probableQ24337

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NML, chain A
Confidence level:very confident
Coverage over the Query: 1-93
View the alignment between query and template
View the model in PyMOL