Citrus Sinensis ID: 044334
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 358 | ||||||
| 297737128 | 4083 | unnamed protein product [Vitis vinifera] | 0.932 | 0.081 | 0.418 | 1e-63 | |
| 225451324 | 1057 | PREDICTED: calcium-transporting ATPase 1 | 0.307 | 0.104 | 0.703 | 5e-44 | |
| 255542302 | 1026 | cation-transporting atpase plant, putati | 0.293 | 0.102 | 0.707 | 1e-43 | |
| 224130658 | 966 | autoinhibited calcium ATPase [Populus tr | 0.293 | 0.108 | 0.715 | 1e-43 | |
| 356570602 | 1065 | PREDICTED: calcium-transporting ATPase 1 | 0.296 | 0.099 | 0.702 | 2e-43 | |
| 356527847 | 966 | PREDICTED: putative calcium-transporting | 0.377 | 0.139 | 0.698 | 4e-43 | |
| 356504963 | 1053 | PREDICTED: calcium-transporting ATPase 1 | 0.296 | 0.100 | 0.694 | 4e-43 | |
| 16508164 | 1062 | type IIB calcium ATPase [Medicago trunca | 0.296 | 0.099 | 0.687 | 4e-43 | |
| 224085537 | 927 | autoinhibited calcium ATPase [Populus tr | 0.301 | 0.116 | 0.676 | 1e-42 | |
| 255542300 | 996 | cation-transporting atpase plant, putati | 0.307 | 0.110 | 0.681 | 1e-42 |
| >gi|297737128|emb|CBI26329.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 249 bits (637), Expect = 1e-63, Method: Compositional matrix adjust.
Identities = 183/437 (41%), Positives = 235/437 (53%), Gaps = 103/437 (23%)
Query: 14 GPKEGWFDGDGVISAVLVVVIVSAVSNFKQSRQFQALANESSDIRV-------------- 59
G KEGW+DG + AV++VV VSAVSNF+Q+RQF+ L+ S++I+V
Sbjct: 1657 GLKEGWYDGGSIFVAVILVVSVSAVSNFRQNRQFEKLSKVSNNIKVDVFRNGRRQQISIF 1716
Query: 60 -----------TGDQIPADGLFLNGHSLKVDECSMTGETDR--WLWLRARHFCWNEHCLG 106
GDQ+PADGLFL+GHSL+VDE SMTGE+D L+AR +G
Sbjct: 1717 EIVVGDVVGLKIGDQVPADGLFLDGHSLQVDESSMTGESDHVEQTPLQAR-LNKLTSSIG 1775
Query: 107 TRDEMGNREFLGTNTKVDDV---IYIIAAAVTIIVVAIPEGLPLALLQ------------ 151
L + VD V + IIAAA TI+ VAIP+GL LA+
Sbjct: 1776 KVGMAVAFLVLVVSLAVDMVHSMVTIIAAAFTILAVAIPKGLLLAVTLILTYSMKRMMAD 1835
Query: 152 ----------EAVG-LNTICN----------------------VYKSNSESTTEI----- 173
E +G TIC + S+S ST +
Sbjct: 1836 QAMVRKLSACETMGSATTICTGKTGTLTLNQMKVTKIWLGQEPIEVSSSISTNLLNLIQQ 1895
Query: 174 --TGSPTEKAILSWAVFDLGMN----RNNTDV--------AAKSLRCMAFARTKVAEADD 219
+GSPTEKAILSWAV +L M+ + N + AA SLRC+AFA T++ +
Sbjct: 1896 GFSGSPTEKAILSWAVLELDMDMEILKQNCTILHQIIQGMAASSLRCIAFAHTQIPGEEH 1955
Query: 220 EVIEGVQFRNLSAEE----GVAKIEN-IRVTARSSVPD-KLLTVQSLKPKGYVVAVTGDG 273
E+ GV +NL G+ I++ R R +V D + V LK KG+VVAVTGD
Sbjct: 1956 EI--GVGLQNLKEHSLTLIGLVGIKDPCRPGVRKAVEDCQCAGVNCLKQKGHVVAVTGDD 2013
Query: 274 TNDAPAPKVADIGPWMGIEGTKWAKEGSDIIIMDDNFTSVVTDQRWGRCVNNNIQKCLQF 333
TNDAPA K A IG MGI+GT+ AKE SDIII+DDNFTSV T RWGRCV +NIQK +Q
Sbjct: 2014 TNDAPALKEAHIGLSMGIQGTEVAKESSDIIILDDNFTSVATVLRWGRCVYDNIQKLIQL 2073
Query: 334 QLTVNFAALIVNIFAAV 350
QLT+N AAL++N+ AAV
Sbjct: 2074 QLTMNVAALVINVVAAV 2090
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225451324|ref|XP_002273945.1| PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255542302|ref|XP_002512214.1| cation-transporting atpase plant, putative [Ricinus communis] gi|223548175|gb|EEF49666.1| cation-transporting atpase plant, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224130658|ref|XP_002328344.1| autoinhibited calcium ATPase [Populus trichocarpa] gi|222838059|gb|EEE76424.1| autoinhibited calcium ATPase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356570602|ref|XP_003553474.1| PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356527847|ref|XP_003532518.1| PREDICTED: putative calcium-transporting ATPase 13, plasma membrane-type-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356504963|ref|XP_003521262.1| PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|16508164|gb|AAL17950.1| type IIB calcium ATPase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224085537|ref|XP_002307612.1| autoinhibited calcium ATPase [Populus trichocarpa] gi|222857061|gb|EEE94608.1| autoinhibited calcium ATPase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255542300|ref|XP_002512213.1| cation-transporting atpase plant, putative [Ricinus communis] gi|223548174|gb|EEF49665.1| cation-transporting atpase plant, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 358 | ||||||
| TAIR|locus:2087363 | 1033 | AT3G63380 [Arabidopsis thalian | 0.377 | 0.130 | 0.651 | 8.5e-74 | |
| TAIR|locus:2084578 | 1017 | AT3G22910 [Arabidopsis thalian | 0.368 | 0.129 | 0.651 | 9.9e-74 | |
| TAIR|locus:2123924 | 1069 | ACA10 "autoinhibited Ca(2+)-AT | 0.432 | 0.144 | 0.579 | 2.1e-55 | |
| TAIR|locus:2094726 | 1086 | ACA9 "autoinhibited Ca(2+)-ATP | 0.432 | 0.142 | 0.560 | 1.8e-51 | |
| TAIR|locus:2175579 | 1074 | ACA8 ""autoinhibited Ca2+ -ATP | 0.432 | 0.144 | 0.541 | 4.6e-46 | |
| TAIR|locus:2082528 | 1025 | ACA11 "autoinhibited Ca2+-ATPa | 0.379 | 0.132 | 0.551 | 4e-44 | |
| TAIR|locus:2029794 | 1020 | ACA1 "autoinhibited Ca2+-ATPas | 0.396 | 0.139 | 0.548 | 3.4e-43 | |
| TAIR|locus:2059201 | 1015 | ACA7 "auto-regulated Ca2+-ATPa | 0.396 | 0.139 | 0.548 | 3.5e-43 | |
| TAIR|locus:2120096 | 1014 | ACA2 "calcium ATPase 2" [Arabi | 0.396 | 0.140 | 0.541 | 4.3e-43 | |
| ASPGD|ASPL0000059437 | 1432 | pmcA [Emericella nidulans (tax | 0.360 | 0.090 | 0.542 | 7.8e-41 |
| TAIR|locus:2087363 AT3G63380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 442 (160.7 bits), Expect = 8.5e-74, Sum P(5) = 8.5e-74
Identities = 88/135 (65%), Positives = 107/135 (79%)
Query: 216 EADDEVIEGVQFRNLSAEEGVAKIENIRVTARSSVPDKLLTVQSLKPKGYVVAVTGDGTN 275
+ +D V+EGVQFRN + EE + K++ IRV ARSS DKLL V+ L+ KG+VVAVTGDGTN
Sbjct: 695 DEEDAVVEGVQFRNYTDEERMQKVDKIRVMARSSPSDKLLMVKCLRLKGHVVAVTGDGTN 754
Query: 276 DAPAPKVADIGPWMGIEGTKWAKEGSDIIIMDDNFTSVVTDQRWGRCVNNNIQKCLQFQL 335
DAPA K ADIG MGI+GT+ AKE SDI+I+DDNF SV T +WGRCV NNIQK +QFQL
Sbjct: 755 DAPALKEADIGLSMGIQGTEVAKESSDIVILDDNFASVATVLKWGRCVYNNIQKFIQFQL 814
Query: 336 TVNFAALIVNIFAAV 350
TVN AAL++N AA+
Sbjct: 815 TVNVAALVINFIAAI 829
|
|
| TAIR|locus:2084578 AT3G22910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2123924 ACA10 "autoinhibited Ca(2+)-ATPase 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094726 ACA9 "autoinhibited Ca(2+)-ATPase 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175579 ACA8 ""autoinhibited Ca2+ -ATPase, isoform 8"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082528 ACA11 "autoinhibited Ca2+-ATPase 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2029794 ACA1 "autoinhibited Ca2+-ATPase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059201 ACA7 "auto-regulated Ca2+-ATPase 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120096 ACA2 "calcium ATPase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000059437 pmcA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 358 | |||
| TIGR01517 | 944 | TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- | 4e-45 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 2e-35 | |
| TIGR01522 | 884 | TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- | 6e-25 | |
| TIGR01106 | 997 | TIGR01106, ATPase-IIC_X-K, sodium or proton efflux | 1e-24 | |
| TIGR01494 | 543 | TIGR01494, ATPase_P-type, ATPase, P-type (transpor | 4e-22 | |
| TIGR01116 | 917 | TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic | 2e-18 | |
| TIGR01523 | 1053 | TIGR01523, ATPase-IID_K-Na, potassium and/or sodiu | 2e-17 | |
| TIGR01517 | 944 | TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- | 4e-16 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 2e-14 | |
| TIGR01525 | 556 | TIGR01525, ATPase-IB_hvy, heavy metal translocatin | 3e-14 | |
| TIGR01512 | 536 | TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb | 2e-12 | |
| TIGR01524 | 867 | TIGR01524, ATPase-IIIB_Mg, magnesium-translocating | 1e-10 | |
| PRK10517 | 902 | PRK10517, PRK10517, magnesium-transporting ATPase | 1e-09 | |
| TIGR01511 | 572 | TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans | 2e-09 | |
| PRK14010 | 673 | PRK14010, PRK14010, potassium-transporting ATPase | 3e-09 | |
| TIGR01497 | 675 | TIGR01497, kdpB, K+-transporting ATPase, B subunit | 5e-08 | |
| COG2216 | 681 | COG2216, KdpB, High-affinity K+ transport system, | 6e-08 | |
| PRK01122 | 679 | PRK01122, PRK01122, potassium-transporting ATPase | 2e-07 | |
| TIGR01647 | 754 | TIGR01647, ATPase-IIIA_H, plasma-membrane proton-e | 9e-07 | |
| pfam00122 | 222 | pfam00122, E1-E2_ATPase, E1-E2 ATPase | 1e-06 | |
| PRK15122 | 903 | PRK15122, PRK15122, magnesium-transporting ATPase; | 2e-06 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 4e-06 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 7e-05 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 9e-05 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 5e-04 | |
| TIGR01494 | 543 | TIGR01494, ATPase_P-type, ATPase, P-type (transpor | 0.001 | |
| COG4087 | 152 | COG4087, COG4087, Soluble P-type ATPase [General f | 0.002 |
| >gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
Score = 164 bits (418), Expect = 4e-45
Identities = 73/129 (56%), Positives = 90/129 (69%)
Query: 222 IEGVQFRNLSAEEGVAKIENIRVTARSSVPDKLLTVQSLKPKGYVVAVTGDGTNDAPAPK 281
+EG +FR+L EE + +RV ARSS DK L V LK G VVAVTGDGTNDAPA K
Sbjct: 629 MEGKEFRSLVYEEMDPILPKLRVLARSSPLDKQLLVLMLKDMGEVVAVTGDGTNDAPALK 688
Query: 282 VADIGPWMGIEGTKWAKEGSDIIIMDDNFTSVVTDQRWGRCVNNNIQKCLQFQLTVNFAA 341
+AD+G MGI GT+ AKE SDII++DDNF S+V +WGR V +NI+K LQFQLTVN A
Sbjct: 689 LADVGFSMGISGTEVAKEASDIILLDDNFASIVRAVKWGRNVYDNIRKFLQFQLTVNVVA 748
Query: 342 LIVNIFAAV 350
+I+ +
Sbjct: 749 VILTFVGSC 757
|
This model describes the P-type ATPase responsible for translocating calcium ions across the plasma membrane of eukaryotes , out of the cell. In some organisms, this type of pump may also be found in vacuolar membranes. In humans and mice, at least, there are multiple isoforms of the PMCA pump with overlapping but not redundant functions. Accordingly, there are no human diseases linked to PMCA defects, although alterations of PMCA function do elicit physiological effects. The calcium P-type ATPases have been characterized as Type IIB based on a phylogenetic analysis which distinguishes this group from the Type IIA SERCA calcium pump. A separate analysis divides Type IIA into sub-types (SERCA and PMR1) which are modelled by TIGR01116 and TIGR01522. This model is well separated from those. Length = 944 |
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|184448 PRK14010, PRK14010, potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|225126 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|234905 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233506 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|215733 pfam00122, E1-E2_ATPase, E1-E2 ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|237914 PRK15122, PRK15122, magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >gnl|CDD|226572 COG4087, COG4087, Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 358 | |||
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| KOG0204 | 1034 | consensus Calcium transporting ATPase [Inorganic i | 100.0 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 100.0 | |
| KOG0202 | 972 | consensus Ca2+ transporting ATPase [Inorganic ion | 100.0 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 100.0 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 100.0 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 100.0 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 100.0 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 100.0 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 100.0 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 100.0 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 100.0 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 100.0 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 100.0 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 100.0 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 100.0 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 100.0 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 100.0 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 100.0 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 100.0 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 100.0 | |
| KOG0203 | 1019 | consensus Na+/K+ ATPase, alpha subunit [Inorganic | 100.0 | |
| KOG0205 | 942 | consensus Plasma membrane H+-transporting ATPase [ | 100.0 | |
| KOG0208 | 1140 | consensus Cation transport ATPase [Inorganic ion t | 100.0 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 100.0 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 100.0 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 100.0 | |
| KOG0209 | 1160 | consensus P-type ATPase [Inorganic ion transport a | 100.0 | |
| KOG0210 | 1051 | consensus P-type ATPase [Inorganic ion transport a | 99.94 | |
| KOG0206 | 1151 | consensus P-type ATPase [General function predicti | 99.89 | |
| PF00122 | 230 | E1-E2_ATPase: E1-E2 ATPase p-type cation-transport | 99.75 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 99.33 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 99.06 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 98.41 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 98.31 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 98.22 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 98.1 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 98.08 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 98.06 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 98.05 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 98.02 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 98.02 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 98.01 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 97.99 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 97.98 | |
| PLN02887 | 580 | hydrolase family protein | 97.97 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 97.75 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 97.65 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.65 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 97.62 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 97.51 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 97.45 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.43 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 97.38 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 97.31 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 96.93 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 96.77 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 96.71 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 96.34 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 96.33 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 96.14 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 95.9 | |
| PLN02954 | 224 | phosphoserine phosphatase | 95.72 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 95.39 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 95.24 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 95.09 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 95.02 | |
| PF13246 | 91 | Hydrolase_like2: Putative hydrolase of sodium-pota | 94.99 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 94.91 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 94.87 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 94.73 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 94.64 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 94.57 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 94.55 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 93.85 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 93.4 | |
| KOG4383 | 1354 | consensus Uncharacterized conserved protein [Funct | 93.39 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 93.11 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 92.31 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 92.28 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 91.85 | |
| PRK08238 | 479 | hypothetical protein; Validated | 91.65 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 91.58 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 90.25 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 89.66 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 89.22 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 88.77 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 87.6 | |
| PLN02580 | 384 | trehalose-phosphatase | 86.99 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 86.73 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 86.19 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 82.77 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 80.24 |
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-65 Score=519.50 Aligned_cols=333 Identities=24% Similarity=0.266 Sum_probs=281.7
Q ss_pred CcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCce-e------------------------CCCccCCCEEEE
Q 044334 17 EGWFDGDGVISAVLVVVIVSAVSNFKQSRQFQALANESSDIR-V------------------------TGDQIPADGLFL 71 (358)
Q Consensus 17 ~~~~~~~~i~~~~~~~~~i~~~~~~~~~~~~~~l~~~~~~~~-V------------------------~G~~IPaDg~vl 71 (358)
..|.+++.++++++++.+++.+...|+++.+++|.++.|+.. + |||+||+||+|+
T Consensus 172 ~yf~~aa~ii~l~~~G~~LE~~a~~ra~~ai~~L~~l~p~~A~~~~~~~~~~~v~v~~v~~GD~v~VrpGE~IPvDG~V~ 251 (713)
T COG2217 172 VYFEEAAMLIFLFLLGRYLEARAKGRARRAIRALLDLAPKTATVVRGDGEEEEVPVEEVQVGDIVLVRPGERIPVDGVVV 251 (713)
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCCEEEEEecCCcEEEEEHHHCCCCCEEEECCCCEecCCeEEE
Confidence 344557778888889999999999999999999998875432 2 999999999999
Q ss_pred eeCceEEecCCCcCCCcceeeecCCceEEE-----------Eeeecccccch----------------------------
Q 044334 72 NGHSLKVDECSMTGETDRWLWLRARHFCWN-----------EHCLGTRDEMG---------------------------- 112 (358)
Q Consensus 72 ~g~~~~vDes~lTGEs~Pv~k~~~~~~~~~-----------V~~~G~~T~~g---------------------------- 112 (358)
+| +..||||+|||||+||.|.+||.+++| |+++|.+|+++
T Consensus 252 ~G-~s~vDeS~iTGEs~PV~k~~Gd~V~aGtiN~~G~l~i~vt~~~~dt~la~Ii~LVe~Aq~~Ka~iqrlaDr~a~~fv 330 (713)
T COG2217 252 SG-SSSVDESMLTGESLPVEKKPGDEVFAGTVNLDGSLTIRVTRVGADTTLARIIRLVEEAQSSKAPIQRLADRVASYFV 330 (713)
T ss_pred eC-cEEeecchhhCCCCCEecCCCCEEeeeEEECCccEEEEEEecCccCHHHHHHHHHHHHhhCCchHHHHHHHHHHccH
Confidence 99 689999999999999999999999998 99999999999
Q ss_pred -------hHHhhhccccc-chHHHHHHHHHHHHHhhcCCchhHHH----------------------------HHHHHhh
Q 044334 113 -------NREFLGTNTKV-DDVIYIIAAAVTIIVVAIPEGLPLAL----------------------------LQEAVGL 156 (358)
Q Consensus 113 -------~~~~~~~~~~~-~~~~~~~~~~~~~lv~a~P~~L~la~----------------------------~~~~~~l 156 (358)
...|..|++.+ .+|..++..++++++++|||||++++ .++++.|
T Consensus 331 p~vl~ia~l~f~~w~~~~~~~~~~a~~~a~avLVIaCPCALgLAtP~ai~~g~g~aA~~GILiK~g~~LE~l~~v~tvvF 410 (713)
T COG2217 331 PVVLVIAALTFALWPLFGGGDWETALYRALAVLVIACPCALGLATPTAILVGIGRAARRGILIKGGEALERLAKVDTVVF 410 (713)
T ss_pred HHHHHHHHHHHHHHHHhcCCcHHHHHHHHHhheeeeCccHHHhHHHHHHHHHHHHHHhCceEEeChHHHHhhccCCEEEE
Confidence 11222232322 57888999999999999999999999 4678999
Q ss_pred CceeeEeecCCCCce-------------------eEcCCccHHHHHHHHHHhcCC-CCCc--------------------
Q 044334 157 NTICNVYKSNSESTT-------------------EITGSPTEKAILSWAVFDLGM-NRNN-------------------- 196 (358)
Q Consensus 157 ~~t~t~~~~~~~~~~-------------------~~~g~~~e~all~~a~~~~~~-~~~~-------------------- 196 (358)
|||||+|+++..-.. ....||...|+++.++ ..+. +.+.
T Consensus 411 DKTGTLT~G~p~v~~v~~~~~~e~~~L~laAalE~~S~HPiA~AIv~~a~-~~~~~~~~~~~~i~G~Gv~~~v~g~~v~v 489 (713)
T COG2217 411 DKTGTLTEGKPEVTDVVALDGDEDELLALAAALEQHSEHPLAKAIVKAAA-ERGLPDVEDFEEIPGRGVEAEVDGERVLV 489 (713)
T ss_pred eCCCCCcCCceEEEEEecCCCCHHHHHHHHHHHHhcCCChHHHHHHHHHH-hcCCCCccceeeeccCcEEEEECCEEEEE
Confidence 999999997431100 1123566666666665 3331 1111
Q ss_pred --------------------hHHHhccCceEEEEeecccc-----------------------C-Cceeeecccccccch
Q 044334 197 --------------------TDVAAKSLRCMAFARTKVAE-----------------------A-DDEVIEGVQFRNLSA 232 (358)
Q Consensus 197 --------------------~~~a~~G~rvl~~a~~~~~~-----------------------~-~~~~ltGd~~~~~~~ 232 (358)
+.+.++|.+++.++.++... + +..|+|||+.+ .+
T Consensus 490 G~~~~~~~~~~~~~~~~~~~~~~~~~G~t~v~va~dg~~~g~i~~~D~~R~~a~~aI~~L~~~Gi~~~mLTGDn~~--~A 567 (713)
T COG2217 490 GNARLLGEEGIDLPLLSERIEALESEGKTVVFVAVDGKLVGVIALADELRPDAKEAIAALKALGIKVVMLTGDNRR--TA 567 (713)
T ss_pred cCHHHHhhcCCCccchhhhHHHHHhcCCeEEEEEECCEEEEEEEEeCCCChhHHHHHHHHHHCCCeEEEEcCCCHH--HH
Confidence 33456788888888776332 3 78999999977 78
Q ss_pred hhhhhccccceeeecCChhhHHHHHHhhcCCCcEEEEecCCCCCCcccccCCcceecCCCchHHHHhcCCEEEeCCCcch
Q 044334 233 EEGVAKIENIRVTARSSVPDKLLTVQSLKPKGYVVAVTGDGTNDAPAPKVADIGPWMGIEGTKWAKEGSDIIIMDDNFTS 312 (358)
Q Consensus 233 ~~~~~~~~~~~v~a~~~P~~K~~iv~~l~~~g~~v~~vGDG~ND~~al~~Advgia~~~~~~~~a~~~adiil~~~~~~~ 312 (358)
+++++.+++++++++++||||.++|+.||++|++|+|||||+||+|||++|||||+|| .|+|+|+++||++++++|+..
T Consensus 568 ~~iA~~lGId~v~AellPedK~~~V~~l~~~g~~VamVGDGINDAPALA~AdVGiAmG-~GtDvA~eaADvvL~~~dL~~ 646 (713)
T COG2217 568 EAIAKELGIDEVRAELLPEDKAEIVRELQAEGRKVAMVGDGINDAPALAAADVGIAMG-SGTDVAIEAADVVLMRDDLSA 646 (713)
T ss_pred HHHHHHcChHhheccCCcHHHHHHHHHHHhcCCEEEEEeCCchhHHHHhhcCeeEeec-CCcHHHHHhCCEEEecCCHHH
Confidence 8999999999999999999999999999999999999999999999999999999999 799999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccC
Q 044334 313 VVTDQRWGRCVNNNIQKCLQFQLTVNFAALIVNIFAAVQKFR 354 (358)
Q Consensus 313 i~~~i~~~r~~~~~i~~~i~~~~~~n~~~~~~~~~g~~~~~~ 354 (358)
++++++++|+++++||||+.|++.||+++++++++|+++||-
T Consensus 647 v~~ai~lsr~t~~~IkqNl~~A~~yn~~~iplA~~g~l~p~~ 688 (713)
T COG2217 647 VPEAIDLSRATRRIIKQNLFWAFGYNAIAIPLAAGGLLTPWI 688 (713)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCHHH
Confidence 999999999999999999999999999999999999998863
|
|
| >KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0205 consensus Plasma membrane H+-transporting ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0208 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0206 consensus P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00122 E1-E2_ATPase: E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature; InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PF13246 Hydrolase_like2: Putative hydrolase of sodium-potassium ATPase alpha subunit | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >KOG4383 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 358 | ||||
| 3ixz_A | 1034 | Pig Gastric H+K+-Atpase Complexed With Aluminium Fl | 6e-21 | ||
| 3n23_A | 992 | Crystal Structure Of The High Affinity Complex Betw | 2e-20 | ||
| 3b8e_A | 998 | Crystal Structure Of The Sodium-Potassium Pump Leng | 2e-20 | ||
| 2zxe_A | 1028 | Crystal Structure Of The Sodium - Potassium Pump In | 4e-20 | ||
| 2dqs_A | 995 | Crystal Structure Of The Calcium Pump With Amppcp I | 9e-13 | ||
| 1kju_A | 994 | Ca2+-Atpase In The E2 State Length = 994 | 9e-13 | ||
| 3ba6_A | 994 | Structure Of The Ca2e1p Phosphoenzyme Intermediate | 1e-12 | ||
| 3tlm_A | 992 | Crystal Structure Of Endoplasmic Reticulum Ca2+-Atp | 4e-12 | ||
| 3rfu_A | 736 | Crystal Structure Of A Copper-Transporting Pib-Type | 1e-08 | ||
| 1mhs_A | 920 | Model Of Neurospora Crassa Proton Atpase Length = 9 | 6e-06 | ||
| 3j09_A | 723 | High Resolution Helical Reconstruction Of The Bacte | 2e-05 | ||
| 3j08_A | 645 | High Resolution Helical Reconstruction Of The Bacte | 2e-05 | ||
| 3b8c_A | 885 | Crystal Structure Of A Plasma Membrane Proton Pump | 4e-05 | ||
| 3a1e_A | 287 | Crystal Structure Of The P- And N-Domains Of His462 | 9e-05 | ||
| 3a1c_A | 287 | Crystal Structure Of The P- And N-Domains Of Copa, | 9e-05 | ||
| 2b8e_A | 273 | Copa Atp Binding Domain Length = 273 | 3e-04 |
| >pdb|3IXZ|A Chain A, Pig Gastric H+K+-Atpase Complexed With Aluminium Fluoride Length = 1034 | Back alignment and structure |
|
| >pdb|3N23|A Chain A, Crystal Structure Of The High Affinity Complex Between Ouabain And The E2p Form Of The Sodium-Potassium Pump Length = 992 | Back alignment and structure |
| >pdb|3B8E|A Chain A, Crystal Structure Of The Sodium-Potassium Pump Length = 998 | Back alignment and structure |
| >pdb|2ZXE|A Chain A, Crystal Structure Of The Sodium - Potassium Pump In The E2.2k+.Pi State Length = 1028 | Back alignment and structure |
| >pdb|2DQS|A Chain A, Crystal Structure Of The Calcium Pump With Amppcp In The Absence Of Calcium Length = 995 | Back alignment and structure |
| >pdb|1KJU|A Chain A, Ca2+-Atpase In The E2 State Length = 994 | Back alignment and structure |
| >pdb|3BA6|A Chain A, Structure Of The Ca2e1p Phosphoenzyme Intermediate Of The Serca Ca2+-Atpase Length = 994 | Back alignment and structure |
| >pdb|3TLM|A Chain A, Crystal Structure Of Endoplasmic Reticulum Ca2+-Atpase (Serca) From Bovine Muscle Length = 992 | Back alignment and structure |
| >pdb|3RFU|A Chain A, Crystal Structure Of A Copper-Transporting Pib-Type Atpase Length = 736 | Back alignment and structure |
| >pdb|1MHS|A Chain A, Model Of Neurospora Crassa Proton Atpase Length = 920 | Back alignment and structure |
| >pdb|3J09|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 723 | Back alignment and structure |
| >pdb|3J08|A Chain A, High Resolution Helical Reconstruction Of The Bacterial P-Type Atpase Copper Transporter Copa Length = 645 | Back alignment and structure |
| >pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump Length = 885 | Back alignment and structure |
| >pdb|3A1E|A Chain A, Crystal Structure Of The P- And N-Domains Of His462gln Mutant Copa, A Copper-Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 | Back alignment and structure |
| >pdb|3A1C|A Chain A, Crystal Structure Of The P- And N-Domains Of Copa, A Copper- Transporting P-Type Atpase, Bound With Amppcp-Mg Length = 287 | Back alignment and structure |
| >pdb|2B8E|A Chain A, Copa Atp Binding Domain Length = 273 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 358 | |||
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 3e-34 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 3e-04 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 5e-34 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 3e-04 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 8e-32 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 3e-24 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 4e-24 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 6e-04 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 3e-11 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 1e-09 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 4e-09 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 1e-08 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 1e-08 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 4e-08 |
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 | Back alignment and structure |
|---|
Score = 133 bits (336), Expect = 3e-34
Identities = 63/184 (34%), Positives = 95/184 (51%), Gaps = 11/184 (5%)
Query: 173 ITG--SPTEKAILSWAVFDLGM--NRNNTDVAAKSLRCMAFARTKVAEADDEVIEGVQFR 228
+TG T KAI A +G+ + T + + + +A VI G+Q +
Sbjct: 626 VTGDHPITAKAI---AA-SVGIISEGSETVEDIAARLRVPVDQVNRKDARACVINGMQLK 681
Query: 229 NLSAEEGVAKIENIRVT--ARSSVPDKLLTVQSLKPKGYVVAVTGDGTNDAPAPKVADIG 286
++ E V + AR+S KL+ V+S + G +VAVTGDG ND+PA K ADIG
Sbjct: 682 DMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIG 741
Query: 287 PWMGIEGTKWAKEGSDIIIMDDNFTSVVTDQRWGRCVNNNIQKCLQFQLTVNFAALIVNI 346
MGI G+ AK +D+I++DDNF S+VT GR + +N++K + + LT N L
Sbjct: 742 VAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELTP-Y 800
Query: 347 FAAV 350
+
Sbjct: 801 LIYI 804
|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 358 | |||
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 100.0 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 100.0 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 100.0 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 100.0 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 100.0 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 100.0 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 100.0 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 100.0 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 99.53 | |
| 2kij_A | 124 | Copper-transporting ATPase 1; actuator, menkes dis | 99.63 | |
| 2hc8_A | 113 | PACS, cation-transporting ATPase, P-type; copper, | 99.62 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.51 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 99.41 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.31 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.27 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 98.94 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 98.76 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 98.75 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 98.66 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.6 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.59 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 98.58 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 98.41 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 98.18 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 98.13 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 98.12 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 98.11 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 98.1 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 98.09 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.03 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 98.03 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 98.01 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.0 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 97.99 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 97.97 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 97.94 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 97.78 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 97.76 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 97.73 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 97.72 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 97.69 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 97.68 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 97.66 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 97.64 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 97.59 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 97.57 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 97.57 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 97.48 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 97.43 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 97.31 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 97.26 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 97.14 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.13 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 97.12 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 97.09 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 97.04 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 96.99 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 96.85 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 96.8 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 96.75 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 96.54 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 96.49 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 96.39 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 96.35 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 96.33 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 96.27 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 96.06 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 95.8 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 95.78 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 95.67 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 95.62 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 95.4 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 95.37 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 95.29 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 95.15 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 95.11 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 95.1 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 95.0 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 94.96 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 94.9 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 94.9 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 94.79 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 94.66 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 94.65 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 94.57 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 94.47 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 94.44 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 94.41 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 94.36 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 94.1 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 93.95 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 93.92 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 93.82 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 93.66 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 93.63 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 93.57 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 93.55 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 93.19 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 92.88 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 92.66 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 92.64 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 92.43 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 92.13 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 91.87 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 91.69 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 91.52 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 91.49 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 91.31 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 91.22 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 90.98 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 90.91 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 90.41 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 90.27 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 90.11 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 89.05 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 88.5 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 88.24 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 87.96 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 87.63 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 83.96 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 82.8 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 81.5 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 80.37 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 80.29 |
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.5e-59 Score=482.12 Aligned_cols=326 Identities=23% Similarity=0.291 Sum_probs=276.3
Q ss_pred CCcchhHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCc-ee------------------------CCCccCCCEE
Q 044334 16 KEGWFDGD-GVISAVLVVVIVSAVSNFKQSRQFQALANESSDI-RV------------------------TGDQIPADGL 69 (358)
Q Consensus 16 ~~~~~~~~-~i~~~~~~~~~i~~~~~~~~~~~~~~l~~~~~~~-~V------------------------~G~~IPaDg~ 69 (358)
.+.|+|++ +++++++++.+++.+++.|+++.+++|.++.++. ++ |||+|||||+
T Consensus 184 ~~~yfe~a~~ii~~~llg~~le~~a~~~~~~ai~~L~~l~p~~a~vv~~dg~~~~v~~~~l~~GDiv~v~~Ge~IPaDg~ 263 (736)
T 3rfu_A 184 VAVYFEAAAVITTLVLLGQVLELKAREQTGSAIRALLKLVPESAHRIKEDGSEEEVSLDNVAVGDLLRVRPGEKIPVDGE 263 (736)
T ss_dssp CCCCHHHHHHHHHHHHHHHHHHHHHHCCCSSHHHHHTCCCCCEEEEEETTEEEEEEETTTCCTTCEECCCSSEECCSCEE
T ss_pred cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCEEEEEecCCEEEEEEHhhCCCCCEEEECCCCcccccEE
Confidence 46799977 4558888889999999999999999998877432 22 9999999999
Q ss_pred EEeeCceEEecCCCcCCCcceeeecCCceEEE-----------Eeeecccccch--------------------------
Q 044334 70 FLNGHSLKVDECSMTGETDRWLWLRARHFCWN-----------EHCLGTRDEMG-------------------------- 112 (358)
Q Consensus 70 vl~g~~~~vDes~lTGEs~Pv~k~~~~~~~~~-----------V~~~G~~T~~g-------------------------- 112 (358)
|++| ++.||||+|||||+||.|++|+.++.| |+++|.+|.++
T Consensus 264 vl~G-~~~VDES~LTGES~Pv~K~~gd~v~~Gt~~~~G~~~~~v~~~G~~T~l~~I~~lv~~a~~~k~~~q~~~d~~a~~ 342 (736)
T 3rfu_A 264 VQEG-RSFVDESMVTGEPIPVAKEASAKVIGATINQTGSFVMKALHVGSDTMLARIVQMVSDAQRSRAPIQRLADTVSGW 342 (736)
T ss_dssp ECSS-CEEEECSSSTTCSSCEEECTTCEECTTCEEESCCCCEEECCCSTTSHHHHHHHHHHHHHSSCCCCCCHHHHHHHH
T ss_pred EEEC-ceEeeecccCCccccEEeccCCcCCCceEeccceEEEEEEEechhhHHHHHHHHHHHhhhcCCHHHHHHHHHHHH
Confidence 9999 679999999999999999999887665 99999999988
Q ss_pred ---------hHHhhhcccccc--hHHHHHHHHHHHHHhhcCCchhHHH----------------------------HHHH
Q 044334 113 ---------NREFLGTNTKVD--DVIYIIAAAVTIIVVAIPEGLPLAL----------------------------LQEA 153 (358)
Q Consensus 113 ---------~~~~~~~~~~~~--~~~~~~~~~~~~lv~a~P~~L~la~----------------------------~~~~ 153 (358)
+..|..++..+. .+..++..++++++++|||+|++++ .++.
T Consensus 343 ~v~~vl~ia~~~~~~w~~~~~~~~~~~~l~~ai~vlviacPcaL~la~p~a~~~~~~~~a~~gilvk~~~alE~l~~v~~ 422 (736)
T 3rfu_A 343 FVPAVILVAVLSFIVWALLGPQPALSYGLIAAVSVLIIACPCALGLATPMSIMVGVGKGAQSGVLIKNAEALERMEKVNT 422 (736)
T ss_dssp HHHHHHHHHHHHHHHHHHHCSSSSTTHHHHHHHHHHHHHCCSTHHHHHHHHHHHHHHHHHHTTEEESCHHHHHHHTSCCE
T ss_pred HHHHHHHHHHHHHHHHHHhCCCchHHHHHHHHHHhHHHhhhhHHHHHHHHHHHHHHHHHhhcceeechHHHHHHhcCCCE
Confidence 111222222221 3678899999999999999999998 3567
Q ss_pred HhhCceeeEeecCCCCce-------------------eEcCCccHHHHHHHHHHhcCCCCCc------------------
Q 044334 154 VGLNTICNVYKSNSESTT-------------------EITGSPTEKAILSWAVFDLGMNRNN------------------ 196 (358)
Q Consensus 154 ~~l~~t~t~~~~~~~~~~-------------------~~~g~~~e~all~~a~~~~~~~~~~------------------ 196 (358)
+++|||||+|+++..-.. ....||.+.|++++++ +.+.....
T Consensus 423 i~fDKTGTLT~g~~~v~~i~~~~~~~~~~l~~aa~le~~s~hPla~Aiv~~a~-~~~~~~~~~~~f~~~~g~gv~~~~~g 501 (736)
T 3rfu_A 423 LVVDKTGTLTEGHPKLTRIVTDDFVEDNALALAAALEHQSEHPLANAIVHAAK-EKGLSLGSVEAFEAPTGKGVVGQVDG 501 (736)
T ss_dssp EEECCBTTTBCSSCEEEEEEESSSCHHHHHHHHHHHHHSSCCHHHHHHHHHHH-TTCCCCCCCSCCCCCTTTEEEECSSS
T ss_pred EEEeCCCCCcCCceEEEEEEecCCCHHHHHHHHHHHhhcCCChHHHHHHHHHH-hcCCCccCcccccccCCceEEEEECC
Confidence 899999999987531000 1235899999999988 65543211
Q ss_pred -------------------------hHHHhccCceEEEEeecccc-----------------------C-Cceeeecccc
Q 044334 197 -------------------------TDVAAKSLRCMAFARTKVAE-----------------------A-DDEVIEGVQF 227 (358)
Q Consensus 197 -------------------------~~~a~~G~rvl~~a~~~~~~-----------------------~-~~~~ltGd~~ 227 (358)
++++++|+|+++++++.... + +..++|||+.
T Consensus 502 ~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~G~~vl~va~d~~~~G~i~i~D~i~~~~~~aI~~L~~~Gi~v~mlTGd~~ 581 (736)
T 3rfu_A 502 HHVAIGNARLMQEHGGDNAPLFEKADELRGKGASVMFMAVDGKTVALLVVEDPIKSSTPETILELQQSGIEIVMLTGDSK 581 (736)
T ss_dssp SCEEEESHHHHHHHCCCCHHHHHHHHHHHHTTCEEEEEEETTEEEEEEEEECCBCSSHHHHHHHHHHHTCEEEEECSSCH
T ss_pred EEEEEcCHHHHHHcCCChhHHHHHHHHHHhcCCeEEEEEECCEEEEEEEeeccchhhHHHHHHHHHHCCCeEEEECCCCH
Confidence 35678999999999875432 3 6789999997
Q ss_pred cccchhhhhhccccceeeecCChhhHHHHHHhhcCCCcEEEEecCCCCCCcccccCCcceecCCCchHHHHhcCCEEEeC
Q 044334 228 RNLSAEEGVAKIENIRVTARSSVPDKLLTVQSLKPKGYVVAVTGDGTNDAPAPKVADIGPWMGIEGTKWAKEGSDIIIMD 307 (358)
Q Consensus 228 ~~~~~~~~~~~~~~~~v~a~~~P~~K~~iv~~l~~~g~~v~~vGDG~ND~~al~~Advgia~~~~~~~~a~~~adiil~~ 307 (358)
. ..+.+++.++...++++++|+||.++++.||++|+.|+|+|||.||+|||+.||+||+|| +|++.++++||+++++
T Consensus 582 ~--~a~~ia~~lgi~~v~a~~~P~~K~~~v~~l~~~g~~V~~vGDG~ND~paL~~AdvGIAmg-~g~d~a~~~AD~vl~~ 658 (736)
T 3rfu_A 582 R--TAEAVAGTLGIKKVVAEIMPEDKSRIVSELKDKGLIVAMAGDGVNDAPALAKADIGIAMG-TGTDVAIESAGVTLLH 658 (736)
T ss_dssp H--HHHHHHHHHTCCCEECSCCHHHHHHHHHHHHHHSCCEEEEECSSTTHHHHHHSSEEEEES-SSCSHHHHHCSEEECS
T ss_pred H--HHHHHHHHcCCCEEEEecCHHHHHHHHHHHHhcCCEEEEEECChHhHHHHHhCCEEEEeC-CccHHHHHhCCEEEcc
Confidence 7 667899999999999999999999999999999999999999999999999999999999 9999999999999999
Q ss_pred CCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 044334 308 DNFTSVVTDQRWGRCVNNNIQKCLQFQLTVNFAALIVNI 346 (358)
Q Consensus 308 ~~~~~i~~~i~~~r~~~~~i~~~i~~~~~~n~~~~~~~~ 346 (358)
+++.++++++++||+++++|+||+.|++.||++.+++++
T Consensus 659 ~~~~~i~~ai~~sr~t~~~i~qnl~~a~~yN~~~iplAa 697 (736)
T 3rfu_A 659 GDLRGIAKARRLSESTMSNIRQNLFFAFIYNVLGVPLAA 697 (736)
T ss_dssp CCSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999987
|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >2kij_A Copper-transporting ATPase 1; actuator, menkes disease, alternative splicing, ATP-binding, cell membrane, cytoplasm, disease mutation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hc8_A PACS, cation-transporting ATPase, P-type; copper, COPA, COPB, actuator, transport protein; 1.65A {Archaeoglobus fulgidus} PDB: 2voy_F | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 358 | ||||
| d1wpga2 | 168 | c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca | 2e-12 | |
| d2feaa1 | 226 | c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio | 3e-08 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 6e-07 | |
| d2b8ea1 | 135 | c.108.1.7 (A:416-434,A:548-663) Cation-transportin | 4e-06 | |
| d1wpga4 | 472 | f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATP | 0.004 |
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Calcium ATPase, catalytic domain P species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Score = 62.5 bits (151), Expect = 2e-12
Identities = 38/105 (36%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
Query: 216 EADDEVIEGVQFRNLSAEEGVAKIENIRVTARSSVPDKLLTVQSLKPKGYVVAVTGDGTN 275
E D G +F +L E AR K V+ L+ + A+TGDG N
Sbjct: 65 EVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVN 124
Query: 276 DAPAPKVADIGPWMGIEGTKWAKEGSDIIIMDDNFTSVVTDQRWG 320
DAPA K A+IG MG GT AK S++++ DDNF+++V G
Sbjct: 125 DAPALKKAEIGIAMG-SGTAVAKTASEMVLADDNFSTIVAAVEEG 168
|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 | Back information, alignment and structure |
|---|
| >d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 472 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 358 | |||
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 99.89 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 99.85 | |
| d1wpga1 | 115 | Calcium ATPase, transduction domain A {Rabbit (Ory | 99.31 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.02 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 98.58 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 98.55 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 98.49 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 98.41 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 98.21 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.17 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 98.17 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 98.16 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 98.14 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 98.07 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 98.05 | |
| d1wpga4 | 472 | Calcium ATPase, transmembrane domain M {Rabbit (Or | 98.02 | |
| d1wpga3 | 239 | Calcium ATPase {Rabbit (Oryctolagus cuniculus) [Ta | 97.96 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 97.96 | |
| d1q3ia_ | 214 | Sodium/potassium-transporting ATPase alpha chain { | 97.78 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 97.73 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 97.44 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.09 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 96.41 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 96.23 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 96.18 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 91.72 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 90.66 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 90.58 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 89.7 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 87.3 | |
| d1y8aa1 | 308 | Hypothetical protein AF1437 {Archaeon Archaeoglobu | 84.23 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 80.73 |
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Calcium ATPase, catalytic domain P species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=99.89 E-value=4.5e-24 Score=179.96 Aligned_cols=99 Identities=36% Similarity=0.488 Sum_probs=87.0
Q ss_pred eeecccccccchhhhhhccccceeeecCChhhHHHHHHhhcCCCcEEEEecCCCCCCcccccCCcceecCCCchHHHHhc
Q 044334 221 VIEGVQFRNLSAEEGVAKIENIRVTARSSVPDKLLTVQSLKPKGYVVAVTGDGTNDAPAPKVADIGPWMGIEGTKWAKEG 300 (358)
Q Consensus 221 ~ltGd~~~~~~~~~~~~~~~~~~v~a~~~P~~K~~iv~~l~~~g~~v~~vGDG~ND~~al~~Advgia~~~~~~~~a~~~ 300 (358)
.++|.++..++..+..+......+|+|++|+||..+++.||+.|++|+|+|||.||+|||++|||||+++ +++++|+++
T Consensus 70 ~~~~~~~~~~~~~~~~~~~~~~~v~ar~~p~~K~~lv~~l~~~g~~Va~vGDG~nD~~AL~~AdvGIa~~-~gt~~a~~a 148 (168)
T d1wpga2 70 AYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKTA 148 (168)
T ss_dssp EEEHHHHHHSCHHHHHHHHHHCCEEESCCHHHHHHHHHHHHHTTCCEEEEECSGGGHHHHHHSSEEEEET-TSCHHHHHT
T ss_pred cccccccchhhHHHHhhhhhhhhhhhccchhHHHHHHHHHHhcccceeEEecCCCCHHHHHhCCEEEEec-cccHHHHHh
Confidence 3444444444444555555667899999999999999999999999999999999999999999999999 999999999
Q ss_pred CCEEEeCCCcchHHHHHHHH
Q 044334 301 SDIIIMDDNFTSVVTDQRWG 320 (358)
Q Consensus 301 adiil~~~~~~~i~~~i~~~ 320 (358)
||+++++++|+.++++|+||
T Consensus 149 Adivl~~~~l~~v~~~I~~G 168 (168)
T d1wpga2 149 SEMVLADDNFSTIVAAVEEG 168 (168)
T ss_dssp CSEEETTCCTHHHHHHHHHH
T ss_pred CCEEEccCCHHHHHHHHHcC
Confidence 99999999999999999986
|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wpga1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|