Citrus Sinensis ID: 044357

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MQMDWMRHLEVGIPALLEDGIRVLIYAGGAIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM
ccccccccHHHHHHHHHHcccEEEEEEcccEEEcccccccccccEEEEEccEEEEEEEEEcccEEEEEEEEccccccccccHHHHHHHHHHHc
ccHHHcHHHHHHHHHHHHccccEEEEEccccccccHHHHcccccccEEEcccEcEEEEccccEEEEEEEEEccccccccccHHHHHHHHHHHc
MQMDWMRHLEVGIPALLEDGIRVLIYAGgaiewfgrkdvvaaptvlfkvdgeeawqmkshgpltffkeqlhdachmvpvdqpkaSLQMLQSWM
MQMDWMRHLEVGIPALLEDGIRVLIYAGGAIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM
MQMDWMRHLEVGIPALLEDGIRVLIYAGGAIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM
****WMRHLEVGIPALLEDGIRVLIYAGGAIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVP***************
MQMDWMRHLEVGIPALLEDGIRVLIYAGGAIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM
MQMDWMRHLEVGIPALLEDGIRVLIYAGGAIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM
*QMDWMRHLEVGIPALLEDGIRVLIYAGGAIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQMDWMRHLEVGIPALLEDGIRVLIYAGGAIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q56WF8510 Serine carboxypeptidase-l yes no 0.978 0.178 0.583 9e-30
P37891500 Serine carboxypeptidase 3 yes no 0.967 0.18 0.551 3e-25
Q41005286 Serine carboxypeptidase-l N/A no 0.967 0.314 0.514 2e-24
P52712429 Serine carboxypeptidase-l no no 0.967 0.209 0.495 1e-23
Q9FFB0505 Serine carboxypeptidase-l no no 0.978 0.180 0.5 3e-23
P32826516 Serine carboxypeptidase-l no no 0.978 0.176 0.5 8e-23
P21529508 Serine carboxypeptidase 3 N/A no 0.967 0.177 0.504 3e-22
P11515500 Serine carboxypeptidase 3 N/A no 0.967 0.18 0.504 4e-22
E5A7I6543 Carboxypeptidase Y homolo N/A no 0.967 0.165 0.427 4e-13
B2WKF1541 Carboxypeptidase Y homolo N/A no 0.967 0.166 0.409 6e-12
>sp|Q56WF8|SCP48_ARATH Serine carboxypeptidase-like 48 OS=Arabidopsis thaliana GN=SCPL48 PE=2 SV=2 Back     alignment and function desciption
 Score =  128 bits (322), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 17/108 (15%)

Query: 1   MQMDWMRHLEVGIPALLEDGIRVLIYAG---------------GAIEWFGRKDVVAAPTV 45
           MQMDWMR+LEVGIPALL+DGI++L+YAG                 +EW G+K+ VAA TV
Sbjct: 391 MQMDWMRNLEVGIPALLQDGIKLLVYAGEYDLICNWLGNSKWVHEMEWSGQKEFVAAATV 450

Query: 46  LFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM 93
            F VD +EA  MK++G LTF K  +HDA HMVP+DQPKA+LQMLQ+WM
Sbjct: 451 PFHVDNKEAGLMKNYGSLTFLK--VHDAGHMVPMDQPKAALQMLQNWM 496
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|P37891|CBP3_ORYSJ Serine carboxypeptidase 3 OS=Oryza sativa subsp. japonica GN=CBP3 PE=2 SV=1 Back     alignment and function description
>sp|Q41005|CBPX_PEA Serine carboxypeptidase-like (Fragment) OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P52712|CBPX_ORYSJ Serine carboxypeptidase-like OS=Oryza sativa subsp. japonica GN=CBP31 PE=2 SV=2 Back     alignment and function description
>sp|Q9FFB0|SCP47_ARATH Serine carboxypeptidase-like 47 OS=Arabidopsis thaliana GN=SCPL47 PE=2 SV=1 Back     alignment and function description
>sp|P32826|SCP49_ARATH Serine carboxypeptidase-like 49 OS=Arabidopsis thaliana GN=SCPL49 PE=2 SV=2 Back     alignment and function description
>sp|P21529|CBP3_HORVU Serine carboxypeptidase 3 OS=Hordeum vulgare GN=CBP3 PE=1 SV=2 Back     alignment and function description
>sp|P11515|CBP3_WHEAT Serine carboxypeptidase 3 OS=Triticum aestivum GN=CBP3 PE=2 SV=1 Back     alignment and function description
>sp|E5A7I6|CBPYA_LEPMJ Carboxypeptidase Y homolog A OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=CPYA PE=3 SV=1 Back     alignment and function description
>sp|B2WKF1|CBPYA_PYRTR Carboxypeptidase Y homolog A OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cpyA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
312282425 510 unnamed protein product [Thellungiella h 0.978 0.178 0.592 1e-28
224118414 501 predicted protein [Populus trichocarpa] 0.978 0.181 0.583 3e-28
15230577 510 carboxypeptidase [Arabidopsis thaliana] 0.978 0.178 0.583 4e-28
255565433 506 Serine carboxypeptidase, putative [Ricin 0.978 0.179 0.592 6e-28
225436490 501 PREDICTED: serine carboxypeptidase-like 0.967 0.179 0.570 1e-27
297734919 460 unnamed protein product [Vitis vinifera] 0.967 0.195 0.570 1e-27
297815648 510 hypothetical protein ARALYDRAFT_484895 [ 0.978 0.178 0.583 1e-27
148469861 502 serine carboxypeptidase III [Nicotiana t 0.967 0.179 0.579 3e-27
16323071 510 AT3g45010/F14D17_80 [Arabidopsis thalian 0.978 0.178 0.574 3e-27
82568706 506 Serine carboxypeptidase [Prunus mume] 0.978 0.179 0.583 3e-26
>gi|312282425|dbj|BAJ34078.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
 Score =  130 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 64/108 (59%), Positives = 77/108 (71%), Gaps = 17/108 (15%)

Query: 1   MQMDWMRHLEVGIPALLEDGIRVLIYAG---------------GAIEWFGRKDVVAAPTV 45
           MQMDWMR+LEVGIP LLEDGI++LIYAG                 +EW G+K+ V+A TV
Sbjct: 391 MQMDWMRNLEVGIPTLLEDGIKMLIYAGEYDLICNWLGNSKWVHEMEWSGQKEFVSAATV 450

Query: 46  LFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM 93
            F VD +EA  MK+HG LTF K  +HDA HMVP+DQPKA+LQMLQ+WM
Sbjct: 451 PFHVDNKEAGLMKNHGSLTFLK--VHDAGHMVPMDQPKAALQMLQNWM 496

Source: Thellungiella halophila

Species: Eutrema halophilum

Genus: Eutrema

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224118414|ref|XP_002331476.1| predicted protein [Populus trichocarpa] gi|222873554|gb|EEF10685.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15230577|ref|NP_190087.1| carboxypeptidase [Arabidopsis thaliana] gi|125987783|sp|Q56WF8.2|SCP48_ARATH RecName: Full=Serine carboxypeptidase-like 48; Flags: Precursor gi|7671402|emb|CAB89316.1| carboxypeptidase precursor-like protein [Arabidopsis thaliana] gi|15215796|gb|AAK91443.1| AT3g45010/F14D17_80 [Arabidopsis thaliana] gi|20334786|gb|AAM16254.1| AT3g45010/F14D17_80 [Arabidopsis thaliana] gi|332644458|gb|AEE77979.1| carboxypeptidase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255565433|ref|XP_002523707.1| Serine carboxypeptidase, putative [Ricinus communis] gi|223537011|gb|EEF38647.1| Serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225436490|ref|XP_002273281.1| PREDICTED: serine carboxypeptidase-like 48-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734919|emb|CBI17153.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297815648|ref|XP_002875707.1| hypothetical protein ARALYDRAFT_484895 [Arabidopsis lyrata subsp. lyrata] gi|297321545|gb|EFH51966.1| hypothetical protein ARALYDRAFT_484895 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|148469861|gb|ABQ65860.1| serine carboxypeptidase III [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|16323071|gb|AAL15270.1| AT3g45010/F14D17_80 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|82568706|dbj|BAE48666.1| Serine carboxypeptidase [Prunus mume] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
TAIR|locus:2075929510 scpl48 "serine carboxypeptidas 0.978 0.178 0.592 2.2e-25
UNIPROTKB|P52712429 CBP31 "Serine carboxypeptidase 0.967 0.209 0.495 6.5e-20
TAIR|locus:2172711505 scpl47 "serine carboxypeptidas 0.946 0.174 0.514 8.8e-20
TAIR|locus:2075845516 SCPL49 "SERINE CARBOXYPEPTIDAS 0.978 0.176 0.5 4.3e-19
ASPGD|ASPL0000030746552 cpyA [Emericella nidulans (tax 0.666 0.112 0.434 1.3e-12
UNIPROTKB|Q96VC4552 cpyA "Carboxypeptidase Y homol 0.666 0.112 0.434 1.3e-12
UNIPROTKB|Q2TYA1542 cpyA "Carboxypeptidase Y homol 0.666 0.114 0.391 2.6e-12
POMBASE|SPAC19G12.10c1002 cpy1 "vacuolar carboxypeptidas 0.946 0.087 0.367 1.3e-08
SGD|S000000343508 YBR139W "Putative carboxypepti 0.838 0.153 0.393 1.7e-08
CGD|CAL0003799542 CPY1 [Candida albicans (taxid: 0.946 0.162 0.323 6e-07
TAIR|locus:2075929 scpl48 "serine carboxypeptidase-like 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 2.2e-25, P = 2.2e-25
 Identities = 64/108 (59%), Positives = 79/108 (73%)

Query:     1 MQMDWMRHLEVGIPALLEDGIRVLIYAG---------G------AIEWFGRKDVVAAPTV 45
             MQMDWMR+LEVGIPALL+DGI++L+YAG         G       +EW G+K+ VAA TV
Sbjct:   391 MQMDWMRNLEVGIPALLQDGIKLLVYAGEYDLICNWLGNSKWVHEMEWSGQKEFVAAATV 450

Query:    46 LFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM 93
              F VD +EA  MK++G LTF K  +HDA HMVP+DQPKA+LQMLQ+WM
Sbjct:   451 PFHVDNKEAGLMKNYGSLTFLK--VHDAGHMVPMDQPKAALQMLQNWM 496
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
UNIPROTKB|P52712 CBP31 "Serine carboxypeptidase-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2172711 scpl47 "serine carboxypeptidase-like 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075845 SCPL49 "SERINE CARBOXYPEPTIDASE-LIKE 49" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000030746 cpyA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q96VC4 cpyA "Carboxypeptidase Y homolog A" [Aspergillus nidulans FGSC A4 (taxid:227321)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TYA1 cpyA "Carboxypeptidase Y homolog A" [Aspergillus oryzae RIB40 (taxid:510516)] Back     alignment and assigned GO terms
POMBASE|SPAC19G12.10c cpy1 "vacuolar carboxypeptidase Y" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000000343 YBR139W "Putative carboxypeptidase with a role in phytochelatin synthesis" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0003799 CPY1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.163.36.1
hypothetical protein (460 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 2e-21
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 1e-17
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 2e-08
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information 
 Score = 86.0 bits (213), Expect = 2e-21
 Identities = 42/110 (38%), Positives = 60/110 (54%), Gaps = 19/110 (17%)

Query: 3   MDWMRHLEVGIPALLEDGIRVLIYAGG---------------AIEWFGRKDVVAAPTVLF 47
           MDWM++    +P LLEDG+RV+IYAG                A++W G  +  AAP V F
Sbjct: 347 MDWMKNFNYTVPGLLEDGVRVMIYAGDMDFICNWIGNKAWTLALQWPGNAEFNAAPDVPF 406

Query: 48  K-VDGEEAWQMKSHGPLT---FFKEQLHDACHMVPVDQPKASLQMLQSWM 93
             VDG  A  ++S    T   F   Q+++A HMVP+DQP  +L M+  ++
Sbjct: 407 SAVDGRWAGLVRSAASNTSSGFSFVQVYNAGHMVPMDQPAVALTMINRFL 456

Length = 462
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 99.93
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 99.93
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 99.92
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 99.92
PLN02209437 serine carboxypeptidase 99.92
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 99.9
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 99.82
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 99.54
PRK03204286 haloalkane dehalogenase; Provisional 95.56
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 95.36
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 94.41
PLN02679360 hydrolase, alpha/beta fold family protein 93.89
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 93.85
PRK10673255 acyl-CoA esterase; Provisional 93.77
PRK10349256 carboxylesterase BioH; Provisional 93.55
PLN03084383 alpha/beta hydrolase fold protein; Provisional 93.2
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 93.14
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 92.96
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 92.91
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 92.73
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 92.53
KOG2382315 consensus Predicted alpha/beta hydrolase [General 92.3
PLN02824294 hydrolase, alpha/beta fold family protein 92.06
PRK00870302 haloalkane dehalogenase; Provisional 91.88
TIGR03611257 RutD pyrimidine utilization protein D. This protei 91.79
PRK08775343 homoserine O-acetyltransferase; Provisional 90.16
PRK03592295 haloalkane dehalogenase; Provisional 90.12
PLN02965255 Probable pheophorbidase 89.67
PRK07581339 hypothetical protein; Validated 89.49
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 87.81
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 87.77
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 87.46
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 86.22
PLN02578354 hydrolase 86.15
PLN02894402 hydrolase, alpha/beta fold family protein 85.75
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 83.75
PRK00175379 metX homoserine O-acetyltransferase; Provisional 83.06
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 81.64
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information 
Probab=99.93  E-value=3.9e-27  Score=174.55  Aligned_cols=87  Identities=41%  Similarity=0.702  Sum_probs=72.6

Q ss_pred             CCccccchhhhHHHHHhcCceEEEEecc---------------eeeecCccccccCCcEeEEECCEeeeEEEeeCCeeEE
Q 044357            2 QMDWMRHLEVGIPALLEDGIRVLIYAGG---------------AIEWFGRKDVVAAPTVLFKVDGEEAWQMKSHGPLTFF   66 (93)
Q Consensus         2 ~~D~~~~~~~~l~~Ll~~girVLiy~Gd---------------~l~w~g~~~f~~~~~~~w~~~~~~~G~~k~~~~ltf~   66 (93)
                      ..|++.++.+.+++||++|+|||||+||               .|+|+|++.|+.++++   .+++++||+|+++||||+
T Consensus       312 ~~d~~~~~~~~l~~lL~~~irVLiy~Gd~D~i~n~~Gt~~~i~~L~w~~~~~f~~~~~~---~~~~~~G~~k~~~~ltf~  388 (415)
T PF00450_consen  312 YDDFMPSSIPDLPELLDNGIRVLIYNGDLDLICNFLGTERWIDNLNWSGKDGFRQWPRK---VNGQVAGYVKQYGNLTFV  388 (415)
T ss_dssp             TCCC-SBCHHHHHHHHHTT-EEEEEEETT-SSS-HHHHHHHHHCTECTEEEEEEEEEEE---TTCSEEEEEEEETTEEEE
T ss_pred             cccccccchhhhhhhhhccceeEEeccCCCEEEEeccchhhhhccccCccccccccccc---ccccccceeEEeccEEEE
Confidence            4688899999999999999999999999               4555555555555444   488999999999999999


Q ss_pred             EeeecCCcccCCCCChHHHHHHHHhhC
Q 044357           67 KEQLHDACHMVPVDQPKASLQMLQSWM   93 (93)
Q Consensus        67 ~~~V~~AGH~vP~dqP~~~~~m~~~f~   93 (93)
                      +  |++||||||.|||++|++||++||
T Consensus       389 ~--V~~AGHmvP~dqP~~a~~m~~~fl  413 (415)
T PF00450_consen  389 T--VRGAGHMVPQDQPEAALQMFRRFL  413 (415)
T ss_dssp             E--ETT--SSHHHHSHHHHHHHHHHHH
T ss_pred             E--EcCCcccChhhCHHHHHHHHHHHh
Confidence            9  999999999999999999999996

Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to MEROPS peptidase family S10 (clan SC). The type example is carboxypeptidase Y from Saccharomyces cerevisiae (Baker's yeast) []. All known carboxypeptidases are either metallo carboxypeptidases or serine carboxypeptidases (3.4.16.5 from EC and 3.4.16.6 from EC). The catalytic activity of the serine carboxypeptidases, like that of the trypsin family serine proteases, is provided by a charge relay system involving an aspartic acid residue hydrogen-bonded to a histidine, which is itself hydrogen-bonded to a serine []. The sequences surrounding the active site serine and histidine residues are highly conserved in all the serine carboxypeptidases.; GO: 0004185 serine-type carboxypeptidase activity, 0006508 proteolysis; PDB: 1AC5_A 1WHS_B 3SC2_B 1WHT_A 1BCR_A 1BCS_A 1GXS_A 1IVY_A 1WPX_A 1YSC_A ....
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 5e-05
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 6e-05
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure 
Iteration: 1

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 19/107 (17%)
Query: 4   DWMRHLEVGIPALLEDGIRVLIYAGGA---IEWFGRK---DVV--------AAPTV---L 46
           DWM+     +  LL   + +L+YAG       W G K   DV+        A+  V    
Sbjct: 311 DWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWT 370
Query: 47  FKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM 93
             +  E A ++KS+   T+ +  + +  HMVP D P+ +L M+  W+
Sbjct: 371 ASITDEVAGEVKSYKHFTYLR--VFNGGHMVPFDVPENALSMVNEWI 415
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 1e-22
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 2e-20
1ivy_A452 Human protective protein; carboxypeptidase, serine 2e-19
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 3e-18
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 4e-17
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
 Score = 88.9 bits (221), Expect = 1e-22
 Identities = 24/110 (21%), Positives = 45/110 (40%), Gaps = 19/110 (17%)

Query: 1   MQMDWMRHLEVGIPALLEDGIRVLIYAG---------------GAIEWFGRKDVVAAPTV 45
              DWM+     +  LL   + +L+YAG                 + W   ++  +    
Sbjct: 308 FAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVR 367

Query: 46  --LFKVDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM 93
                +  E A ++KS+   T+ +  + +  HMVP D P+ +L M+  W+
Sbjct: 368 NWTASITDEVAGEVKSYKHFTYLR--VFNGGHMVPFDVPENALSMVNEWI 415
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 99.97
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 99.97
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 99.97
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 99.96
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 99.96
1ivy_A452 Human protective protein; carboxypeptidase, serine 99.94
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 94.59
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 94.56
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 93.97
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 93.94
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 93.91
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 93.86
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 93.72
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 93.68
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 93.62
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 93.58
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 93.52
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 93.46
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 93.28
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 93.26
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 93.19
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 93.17
1iup_A282 META-cleavage product hydrolase; aromatic compound 93.16
1r3d_A264 Conserved hypothetical protein VC1974; structural 93.14
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 93.01
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 92.94
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 92.83
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 92.79
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 92.73
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 92.68
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 92.64
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 92.61
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 92.6
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 92.52
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 92.52
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 92.52
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 92.49
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 92.44
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 92.42
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 92.35
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 92.35
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 92.33
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 92.01
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 91.96
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 91.84
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 91.75
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 91.58
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 91.14
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 90.83
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 90.79
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 90.76
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 90.73
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 90.72
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 90.71
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 90.55
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 90.54
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 90.53
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 90.48
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 90.41
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 90.16
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 90.12
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 89.61
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 90.07
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 89.92
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 89.74
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 89.74
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 89.63
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 89.42
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 89.41
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 88.75
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 88.73
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 88.73
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 88.68
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 88.26
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 88.2
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 88.1
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 87.99
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 87.59
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 86.98
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 86.93
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 86.44
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 86.22
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 86.08
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 85.66
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 85.39
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 85.0
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 84.5
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 84.45
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 84.17
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 84.16
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 84.04
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 83.93
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 83.61
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 82.52
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 81.33
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 81.28
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 80.92
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 80.41
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 80.02
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
Probab=99.97  E-value=5.7e-33  Score=184.95  Aligned_cols=89  Identities=19%  Similarity=0.293  Sum_probs=82.6

Q ss_pred             CccccchhhhHHHHHhcCceEEEEecc---eeeecCcccccc-------CCcEeEEECCEeeeEEEeeCCeeEEEeeecC
Q 044357            3 MDWMRHLEVGIPALLEDGIRVLIYAGG---AIEWFGRKDVVA-------APTVLFKVDGEEAWQMKSHGPLTFFKEQLHD   72 (93)
Q Consensus         3 ~D~~~~~~~~l~~Ll~~girVLiy~Gd---~l~w~g~~~f~~-------~~~~~w~~~~~~~G~~k~~~~ltf~~~~V~~   72 (93)
                      .|.++++++.+++||++|+|||||+||   .|+|.|++.|.+       .+|++|+++++++||+|+++||||++  |++
T Consensus        47 ~d~~~s~~~~~~~Ll~~girvlIy~Gd~D~i~~~~Gt~~~i~~L~w~~~~~~~~w~~~~~vaG~~~~~~~Ltf~~--V~~  124 (153)
T 1whs_B           47 HDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS--VRG  124 (153)
T ss_dssp             CCCCSBCHHHHHHHHHTTCEEEEEEETTCSSSCHHHHHHHHHTTTCCEEEEEEEEEETTEEEEEEEEETTEEEEE--ETT
T ss_pred             hhccccHHHHHHHHHhcCceEEEEecCcCcccccHhHHHHHHhCCCCCcccccceeECCCccEEEEEeCeEEEEE--ECC
Confidence            478889999999999999999999999   888888877753       47899999999999999999999999  999


Q ss_pred             CcccCCCCChHHHHHHHHhhC
Q 044357           73 ACHMVPVDQPKASLQMLQSWM   93 (93)
Q Consensus        73 AGH~vP~dqP~~~~~m~~~f~   93 (93)
                      ||||||.|||++|++||++||
T Consensus       125 AGHmVP~dqP~~a~~m~~~fl  145 (153)
T 1whs_B          125 AGHEVPLHRPRQALVLFQYFL  145 (153)
T ss_dssp             CCSSHHHHSHHHHHHHHHHHH
T ss_pred             CcccCcccCHHHHHHHHHHHH
Confidence            999999999999999999995
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 1e-17
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 5e-17
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 1e-16
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 1e-16
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 2e-16
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Serine carboxypeptidase-like
domain: Serine carboxypeptidase II
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 73.7 bits (180), Expect = 1e-17
 Identities = 24/110 (21%), Positives = 46/110 (41%), Gaps = 19/110 (17%)

Query: 1   MQMDWMRHLEVGIPALLEDGIRVLIYAG---------------GAIEWFGRKDVVAAPTV 45
              DWM+     +  LL   + +L+YAG                 + W   ++  +    
Sbjct: 308 FAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVR 367

Query: 46  LFK--VDGEEAWQMKSHGPLTFFKEQLHDACHMVPVDQPKASLQMLQSWM 93
            +   +  E A ++KS+   T+ +  + +  HMVP D P+ +L M+  W+
Sbjct: 368 NWTASITDEVAGEVKSYKHFTYLR--VFNGGHMVPFDVPENALSMVNEWI 415
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 99.95
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 99.95
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 99.94
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 99.92
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 99.92
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 96.25
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 96.09
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 95.93
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 95.89
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 95.82
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 95.56
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 95.49
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 95.01
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 94.97
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 94.81
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 94.8
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 94.79
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 94.78
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 94.71
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 94.67
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 94.55
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 94.53
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 94.48
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 94.4
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 94.31
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 93.44
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 91.69
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 91.0
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 89.98
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 89.68
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 87.44
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Serine carboxypeptidase-like
domain: Serine carboxypeptidase II
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.95  E-value=1.4e-29  Score=186.55  Aligned_cols=90  Identities=27%  Similarity=0.591  Sum_probs=85.7

Q ss_pred             CCccccchhhhHHHHHhcCceEEEEecc---------------eeeecCccccccCCcEeEEE--CCEeeeEEEeeCCee
Q 044357            2 QMDWMRHLEVGIPALLEDGIRVLIYAGG---------------AIEWFGRKDVVAAPTVLFKV--DGEEAWQMKSHGPLT   64 (93)
Q Consensus         2 ~~D~~~~~~~~l~~Ll~~girVLiy~Gd---------------~l~w~g~~~f~~~~~~~w~~--~~~~~G~~k~~~~lt   64 (93)
                      ..|.++++.+.+++||++|+||||||||               .|+|++.++|.++++++|+.  +++++||+|+++|||
T Consensus       309 ~~d~~~~~~~~l~~LL~~~irVLIysGd~D~~~p~~Gte~~i~~L~w~~~~~f~~~~~~~w~~~~~~~~aG~~~~~~nlt  388 (421)
T d1wpxa1         309 AGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFT  388 (421)
T ss_dssp             TTCTTCCTTHHHHHHHHTTCCEEEEEETTCSTTCHHHHHHHHHHCCSTTHHHHHHSCCEEEECTTTCSEEEEEEEETTEE
T ss_pred             cCcccCcHHHHHHHHHhcCCeEEEEeCCcCccCCchhHHHHHHhCCCCcccchhcCcccceeecCCCeEEEEEEEECCeE
Confidence            4789999999999999999999999999               78899999999999999985  579999999999999


Q ss_pred             EEEeeecCCcccCCCCChHHHHHHHHhhC
Q 044357           65 FFKEQLHDACHMVPVDQPKASLQMLQSWM   93 (93)
Q Consensus        65 f~~~~V~~AGH~vP~dqP~~~~~m~~~f~   93 (93)
                      |++  |++||||||.|||++|++||++||
T Consensus       389 f~~--V~~AGHmvP~d~P~~a~~m~~~fi  415 (421)
T d1wpxa1         389 YLR--VFNGGHMVPFDVPENALSMVNEWI  415 (421)
T ss_dssp             EEE--ETTCCSSHHHHCHHHHHHHHHHHH
T ss_pred             EEE--ECCccccCcccCHHHHHHHHHHHh
Confidence            999  999999999999999999999996
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure