Citrus Sinensis ID: 044362


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
KKKKAKYDGRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKFETPEQRAERLAARYPKRNTLQPVDTSEGLTMMPVSSSAKKKGKRSVKNEGDQEQKQRSKQPVKDEKQA
cccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccEEccccEEEEEEcccccccccccccccccHHHHHcccccccccccc
ccccccccccEEcccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccEEEEEccccEEEEEEccccccccccEccccccHHHHcccccccccccc
kkkkakydgrthslphkkngpytcpkcnqAFAKSQIYAAHVssghykfetPEQRAERLAArypkrntlqpvdtsegltmmpvsssakkkgkrsvknegdqeqkqrskqpvkdekqa
kkkkakydgrthslphkkngpytCPKCNQAFAKSQIYAAHVSSGHYKFETPEQRAERLaarypkrntlqpvdtsegltmmpvsssakkkgkrsvknegdqeqkqrskqpvkdekqa
KKKKAKYDGRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKFETPEQRAERLAARYPKRNTLQPVDTSEGLTMMPVSSSAKKKGKRSVKNEGDQEQKQRSKQPVKDEKQA
*********************YTCPKCNQAFAKSQIYAAHVSSGHY**********************************************************************
******Y*GRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHV****************************PVDTSEGLTM*************************************
**********THSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKFETPEQRAERLAARYPKRNTLQPVDTSEGLTMMP***********************************
*****KYDGRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKFETPEQRAERLAARYPKRNTLQPVDTSEGLTMMPVSSS*******************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KKKKAKYDGRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKFETPEQRAERLAARYPKRNTLQPVDTSEGLTMMPVSSSAKKKGKRSVKNEGDQEQKQRSKQPVKDEKQA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
255647072 325 unknown [Glycine max] 0.646 0.230 0.605 7e-18
356536552 325 PREDICTED: uncharacterized protein LOC10 0.646 0.230 0.605 7e-18
255574424 475 hypothetical protein RCOM_0146500 [Ricin 0.818 0.2 0.505 1e-17
297812445 340 zinc finger family protein [Arabidopsis 0.551 0.188 0.625 2e-15
15237189 324 C2H2-like zinc finger protein [Arabidops 0.543 0.194 0.603 3e-14
116830465 302 unknown [Arabidopsis thaliana] 0.517 0.198 0.639 5e-14
91805447 301 zinc finger family protein [Arabidopsis 0.517 0.199 0.639 5e-14
357462875 256 C2H2-type zinc finger protein-like prote 0.767 0.347 0.472 6e-14
15224184 251 C2H2-like zinc finger protein [Arabidops 0.517 0.239 0.639 6e-14
297836188 330 zinc finger family protein [Arabidopsis 0.517 0.181 0.622 2e-13
>gi|255647072|gb|ACU24004.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score = 94.7 bits (234), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/76 (60%), Positives = 55/76 (72%), Gaps = 1/76 (1%)

Query: 6   KYDGRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKFETPEQRAERLAARYPKR 65
           KYDGR HS P+KKNGPYTCPKC   F  SQ +AAHVSS HYK+ET  +R +RL A+  KR
Sbjct: 186 KYDGRMHSYPYKKNGPYTCPKCGHVFETSQRFAAHVSSSHYKYETKSERKKRLMAKIRKR 245

Query: 66  NTLQPVDTSEGLTMMP 81
           N L+    S GLT++P
Sbjct: 246 N-LRIEWVSGGLTVVP 260




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356536552|ref|XP_003536801.1| PREDICTED: uncharacterized protein LOC100788426 [Glycine max] Back     alignment and taxonomy information
>gi|255574424|ref|XP_002528125.1| hypothetical protein RCOM_0146500 [Ricinus communis] gi|223532464|gb|EEF34255.1| hypothetical protein RCOM_0146500 [Ricinus communis] Back     alignment and taxonomy information
>gi|297812445|ref|XP_002874106.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297319943|gb|EFH50365.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15237189|ref|NP_197690.1| C2H2-like zinc finger protein [Arabidopsis thaliana] gi|10177246|dbj|BAB10620.1| C2H2-type zinc finger protein-like [Arabidopsis thaliana] gi|332005722|gb|AED93105.1| C2H2-like zinc finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|116830465|gb|ABK28190.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|91805447|gb|ABE65452.1| zinc finger family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357462875|ref|XP_003601719.1| C2H2-type zinc finger protein-like protein [Medicago truncatula] gi|355490767|gb|AES71970.1| C2H2-type zinc finger protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|15224184|ref|NP_179439.1| C2H2-like zinc finger protein [Arabidopsis thaliana] gi|4218009|gb|AAD12217.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana] gi|225898116|dbj|BAH30390.1| hypothetical protein [Arabidopsis thaliana] gi|330251680|gb|AEC06774.1| C2H2-like zinc finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297836188|ref|XP_002885976.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297331816|gb|EFH62235.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
TAIR|locus:2046318251 AT2G18490 "AT2G18490" [Arabido 0.810 0.374 0.475 4.1e-17
TAIR|locus:2172716324 AT5G22990 "AT5G22990" [Arabido 0.543 0.194 0.603 1.9e-16
TAIR|locus:2053598329 AT2G15740 "AT2G15740" [Arabido 0.491 0.173 0.603 1.2e-14
TAIR|locus:2163857300 AT5G42640 "AT5G42640" [Arabido 0.508 0.196 0.583 3.5e-14
ZFIN|ZDB-GENE-030131-9559 2620 znf292b "zinc finger protein 2 0.784 0.034 0.298 0.00085
TAIR|locus:2046318 AT2G18490 "AT2G18490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 210 (79.0 bits), Expect = 4.1e-17, P = 4.1e-17
 Identities = 49/103 (47%), Positives = 61/103 (59%)

Query:     1 KKKKAKYDGRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKFETPEQRAERLAA 60
             K   A+YDGR HSLP+KK GPYTCPKCN  F  SQ +AAH+SS HYK ET ++RA+R  A
Sbjct:   148 KSDDAQYDGRIHSLPYKKYGPYTCPKCNSIFDTSQKFAAHMSS-HYKSETNKERAQRFRA 206

Query:    61 RYPKRNTLQPVDTSEGLTMMPVSSSAKKKGKRSVKNEGDQEQK 103
             R  KR   +       L +     S K K +  V N+G  + K
Sbjct:   207 RN-KRKYRK-------LNLEVYGESQKIKQEDGVHNDGRSDDK 241




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2172716 AT5G22990 "AT5G22990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053598 AT2G15740 "AT2G15740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163857 AT5G42640 "AT5G42640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9559 znf292b "zinc finger protein 292b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
scaffold_602360.1
annotation not avaliable (340 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
PRK12862 763 PRK12862, PRK12862, malic enzyme; Reviewed 4e-04
>gnl|CDD|183799 PRK12862, PRK12862, malic enzyme; Reviewed Back     alignment and domain information
 Score = 37.9 bits (89), Expect = 4e-04
 Identities = 19/41 (46%), Positives = 24/41 (58%)

Query: 76  GLTMMPVSSSAKKKGKRSVKNEGDQEQKQRSKQPVKDEKQA 116
           GL M PV ++AK   KR V  EG+ E+  R+ Q V DE  A
Sbjct: 433 GLIMKPVFAAAKAAPKRVVFAEGEDERVLRAAQVVVDEGLA 473


Length = 763

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.26
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.94
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 98.78
KOG1074958 consensus Transcriptional repressor SALM [Transcri 98.65
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 98.62
KOG3576267 consensus Ovo and related transcription factors [T 98.58
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 98.54
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 98.4
KOG3576267 consensus Ovo and related transcription factors [T 98.12
PHA0276855 hypothetical protein; Provisional 98.04
PHA0061644 hypothetical protein 97.9
PHA0276855 hypothetical protein; Provisional 97.76
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.63
KOG3608 467 consensus Zn finger proteins [General function pre 97.54
PHA00733128 hypothetical protein 97.49
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.37
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.34
PHA00733128 hypothetical protein 97.16
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.75
smart0035526 ZnF_C2H2 zinc finger. 96.69
KOG3608467 consensus Zn finger proteins [General function pre 96.37
PHA0073279 hypothetical protein 96.08
PHA0073279 hypothetical protein 96.04
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.57
KOG3993500 consensus Transcription factor (contains Zn finger 95.49
PHA0061644 hypothetical protein 95.22
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.61
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.26
COG5048467 FOG: Zn-finger [General function prediction only] 93.21
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.07
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.99
PLN03086567 PRLI-interacting factor K; Provisional 92.94
COG5189423 SFP1 Putative transcriptional repressor regulating 92.89
PLN03086567 PRLI-interacting factor K; Provisional 92.71
KOG3993 500 consensus Transcription factor (contains Zn finger 92.21
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 91.35
COG5189423 SFP1 Putative transcriptional repressor regulating 90.96
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 89.98
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 88.92
COG404965 Uncharacterized protein containing archaeal-type C 87.21
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.26  E-value=1.5e-12  Score=94.68  Aligned_cols=50  Identities=26%  Similarity=0.495  Sum_probs=44.3

Q ss_pred             CCcCCchhhhhhccccCCCcceeccccchhccCchhhHHHhHhccCCCCCh
Q 044362            1 KKKKAKYDGRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKFETP   51 (116)
Q Consensus         1 k~~~~ks~L~~H~r~Htgekp~~C~~C~k~F~~~~~l~~H~~~~h~~~~~~   51 (116)
                      |.|.-.=-|..|+|+|||||||.|+.|+++|...+||+.|+.+ |.+.+.+
T Consensus       195 KaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQT-HS~~K~~  244 (279)
T KOG2462|consen  195 KAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQT-HSDVKKH  244 (279)
T ss_pred             ccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHh-hcCCccc
Confidence            4555555689999999999999999999999999999999999 9998754



>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.47
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.25
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.2
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.15
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.14
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.13
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.08
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.03
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.03
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.02
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.02
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.02
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.01
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.0
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.99
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.98
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.98
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.97
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.97
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.97
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.96
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.94
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.92
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.91
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.91
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.9
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 98.89
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.88
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.88
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.87
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.87
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.86
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.86
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.85
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.85
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.84
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.84
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.83
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.83
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.81
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.8
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.79
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.78
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.78
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.77
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.77
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.77
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.77
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.76
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.76
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.76
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.75
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.75
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.73
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.71
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.7
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.68
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.68
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.68
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 98.68
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.67
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.67
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.66
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.66
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.65
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.63
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.62
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.62
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.62
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.61
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.6
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.6
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.59
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.59
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.59
1tf6_A190 Protein (transcription factor IIIA); complex (tran 98.58
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.58
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.58
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 98.57
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 98.56
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.56
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.52
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.51
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.49
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.49
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.49
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.48
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.46
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.46
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.45
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.44
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.44
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.44
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.43
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.43
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.36
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.35
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.34
1tf6_A190 Protein (transcription factor IIIA); complex (tran 98.32
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.31
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.3
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.3
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.29
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.29
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.28
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.6
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.25
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.25
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.56
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.24
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.23
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.54
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.22
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.21
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.13
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.13
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.1
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.1
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.08
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.03
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.03
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.03
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.03
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.03
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.03
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.03
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.02
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.01
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.01
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.0
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.99
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.98
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.97
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.97
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 97.97
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.97
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.97
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 97.97
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.96
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.96
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.96
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.96
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.95
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.95
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.95
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.95
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.94
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.93
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 97.93
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.93
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 97.92
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.92
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.92
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.92
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.91
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 97.9
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 97.89
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.87
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.8
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 97.77
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.76
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 97.71
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.7
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.69
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.69
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.68
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.68
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.68
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.68
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 97.67
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.66
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.65
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.65
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.64
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.63
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 97.63
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.62
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 97.61
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.59
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.59
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.59
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 97.58
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.58
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.58
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.58
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 97.57
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 97.56
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 97.55
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.55
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.54
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.53
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.52
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.52
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.51
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.5
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.5
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.48
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.46
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 97.46
2epa_A72 Krueppel-like factor 10; transforming growth facto 97.45
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.45
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.43
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.43
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.41
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 97.39
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.33
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.33
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 97.31
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.31
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.27
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.24
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 97.17
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.13
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 97.07
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.04
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 97.03
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 97.01
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 96.94
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 96.88
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.53
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 96.24
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 95.93
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 95.81
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 95.54
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.38
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 95.33
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 94.98
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.93
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 94.89
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 93.73
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 94.65
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.56
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 94.53
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.25
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 94.23
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.92
1paa_A30 Yeast transcription factor ADR1; transcription reg 93.89
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.37
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 92.8
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 89.84
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 89.21
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 88.99
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 85.17
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 80.91
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.47  E-value=7.5e-15  Score=84.34  Aligned_cols=47  Identities=21%  Similarity=0.382  Sum_probs=44.9

Q ss_pred             CCcCCchhhhhhccccCCCcceeccccchhccCchhhHHHhHhccCCC
Q 044362            1 KKKKAKYDGRTHSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKF   48 (116)
Q Consensus         1 k~~~~ks~L~~H~r~Htgekp~~C~~C~k~F~~~~~l~~H~~~~h~~~   48 (116)
                      |.|...+.|..|+++|+|++||.|..|+++|...++|..|+++ |+|.
T Consensus        12 k~F~~~~~L~~H~~~Ht~ekp~~C~~C~k~F~~~~~L~~H~~~-Htge   58 (60)
T 4gzn_C           12 KTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKV-HQNK   58 (60)
T ss_dssp             CEESSHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHGGG-GSCC
T ss_pred             CEeCCHHHHHHHHHHhCCCcCeECCCCCCCcCCHHHHHHHhCc-cCCC
Confidence            5789999999999999999999999999999999999999999 9985



>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.46
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.44
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.38
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.37
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.37
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.34
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.29
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.18
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.15
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.01
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.0
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.97
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.78
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.73
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.68
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.64
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.63
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.56
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.49
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.47
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.46
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.07
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.06
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.0
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.98
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.69
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.43
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.42
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.39
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.34
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.34
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.33
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.32
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.26
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.23
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.18
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.02
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.02
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.92
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.91
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.82
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.82
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.69
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.61
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.56
d2cota238 Zinc finger and SCAN domain-containing protein 16, 96.51
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 96.29
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.27
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.15
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.13
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 96.06
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 95.92
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.86
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.82
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.79
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 95.64
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.02
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.86
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.72
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.64
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.39
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.3
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 93.91
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 93.91
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 92.04
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.2
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.17
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.59
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.95
d1y0jb136 U-shaped transcription factor, different fingers { 88.56
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.14
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.13
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.09
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 85.39
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 83.86
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger and SCAN domain-containing protein 16, ZSCAN16
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.46  E-value=8.5e-15  Score=75.56  Aligned_cols=37  Identities=19%  Similarity=0.444  Sum_probs=35.4

Q ss_pred             hhccccCCCcceeccccchhccCchhhHHHhHhccCCC
Q 044362           11 THSLPHKKNGPYTCPKCNQAFAKSQIYAAHVSSGHYKF   48 (116)
Q Consensus        11 ~H~r~Htgekp~~C~~C~k~F~~~~~l~~H~~~~h~~~   48 (116)
                      +|+++|++++||.|..||++|.+.++|..|+++ |+|.
T Consensus         2 rH~~~Ht~ekpy~C~~CgK~F~~~s~L~~H~r~-HtGE   38 (38)
T d2cota2           2 RSEWQQRERRRYKCDECGKSFSHSSDLSKHRRT-HTGE   38 (38)
T ss_dssp             CCCSCCCCSCSSBCSSSCCBCSCHHHHHHHHTT-TCCS
T ss_pred             ccCcccCCCCCEecCCCCceeeCHHHHHHhCcc-CCCC
Confidence            689999999999999999999999999999999 9983



>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure