Citrus Sinensis ID: 044367

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450

MPSSHAILLLSLITLPFTSTRIFTSTTAAPAAGKPKRLVTKLLHRDSLLYNPNDTVDAQAQRTLNMSMARFIYLSQKSSQKAHDTRAHLHPGISTVPVFYVNFSIGQPPVPQLAVLDTGSSLIWVKCQPCEQCGATTFDPSKSLTYATLPCDSSYCTNDCGGYPDECWYNIRYTNGPDSQGTIGSEQFNFETSDEGKTFLYDVGFGCSHNNAHFSDEQFTGVFGLGPATSSTHSLVEKVGSKFSYCIGNLNYFEYAYNMLILGEGAILEGDSTPMSVIDGSYYVTLEGISLGEKMLDIDPNLFKKNDTWSDAGVFIDSGTTLTWLVPSAYQTLRKEVEDLFQGLLPSYPMDPAWHLCYSGNINRDLQGFPAMAFHFAGGADLVLDAESVFYQESSSVFCLAVGPSDINGERFKDLSIIGMIAQQNYNVAYDLVSKQLYFQRIDCELLADD

cccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEcccccCEEEEEEccccccEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEccccCEEEEEEEEEEEECcccccccCCccEEEEECccccccccccccEEEEccccccccHHHHHHccccEEEEEccccccccccEEEEccccccccccccccccccccEEEEEEEEEEccEEEcccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHcccccccccccccccEEccccccccccccEEEEEccccEEEEccccEEEEEcccEEEEEEECccccccccccEEEEEEEEEEEEEEEEEccccEEEEEcccccccccc

***SHAILLLSLITLPFTSTRIFTSTTAAPAAGKPKRLVTKLLHRDSLLYNPNDTVDAQAQRTLNMSMARFIYL************AHLHPGISTVPVFYVNFSIGQPPVPQLAVLDTGSSLIWVKCQPCEQCGATTFDPSKSLTYATLPCDSSYCTNDCGGYPDECWYNIRYTNGPDSQGTIGSEQFNFETSDEGKTFLYDVGFGCSHNNAHFSDEQFTGVFGLGPATSSTHSLVEKVGSKFSYCIGNLNYFEYAYNMLILGEGAILEGDSTPMSVIDGSYYVTLEGISLGEKMLDIDPNLFKKNDTWSDAGVFIDSGTTLTWLVPSAYQTLRKEVEDLFQGLLPSYPMDPAWHLCYSGNINRDLQGFPAMAFHFAGGADLVLDAESVFYQESSSVFCLAVGPSDINGERFKDLSIIGMIAQQNYNVAYDLVSKQLYFQRIDCELL***

xxxxxxxxxxxxxxxxxxxxxxxxHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.4.-.-	Acting on peptide bonds (peptide hydrolases).	probable
3.4.23.-	Aspartic endopeptidases.	probable
3.4.23.12	Nepenthesin.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TZS, chain A
Confidence level:very confident
Coverage over the Query: 95-148,165-299,310-443
View the alignment between query and template
View the model in PyMOL

Template: 2EWY, chain A
Confidence level:very confident
Coverage over the Query: 97-148,165-448
View the alignment between query and template
View the model in PyMOL

Template: 3VLA, chain A
Confidence level:very confident
Coverage over the Query: 86-130,141-448
View the alignment between query and template
View the model in PyMOL