Citrus Sinensis ID: 044385

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MGSKTSASLALFLAVNILFFALVTACGSCPSPKPKPKPKPTPSPSGASCPRDALKLGVCANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLNVCSKSVPRGFQCA
ccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccHHHcccccHHHHHHHHHHHHcccccEEEcccHHHHHHHHHcccccccccccc
*****SASLALFLAVNILFFALVTACGS***********************DALKLGVCANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLNVCSKSVPRGFQCA
xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSKTSASLALFLAVNILFFALVTACGSCPSPKPKPKPKPTPSPSGASCPRDALKLGVCANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLNVCSKSVPRGFQCA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
14 kDa proline-rich protein DC2.15 May be connected with the initiation of embryogenesis or with the metabolic changes produced by the removal of auxins.probableP14009

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HYP, chain A
Confidence level:very confident
Coverage over the Query: 47-132
View the alignment between query and template
View the model in PyMOL