Citrus Sinensis ID: 044394


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
KGKTHVQDKNPGKNPNNVQNPNRKENQDVEYDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHYKYETSAERKRRLSARLKKRNLRLVHSTEGLTMMPQPSNEQMRVKARKRNGHGEANTSVEIEVEVEKLLKID
ccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccEEEccccEEEEEccccHHHHHHHHHcccccccccHHHHHHHHHHHHccc
ccccEEccccccccccccccHcHcccccccccccEEccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccEEEEEEcccccccccEEEEEEEHHHHHccc
kgkthvqdknpgknpnnvqnpnrkenqdveydgrihshpckkygpykcpkcngafgtSQAFAAHMRSHYKYETSAERKRRLSARLKKRNLrlvhstegltmmpqpsneQMRVKARKrnghgeantsVEIEVEVEKLLKID
kgkthvqdknpgknpnnvqnpnrkeNQDVEYDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHYKYETSAERKRRLsarlkkrnlrlvhstegltmmpqpsneQMRVKARKrnghgeantsveievevekllkid
KGKTHVQDKNPGKNPNNVQNPNRKENQDVEYDGRIHSHpckkygpykcpkcNGAFGTSQAFAAHMRSHYKYETSAErkrrlsarlkkrnlrlVHSTEGLTMMPQPSNEQMRVKARKRNGHGEANTSveievevekllkiD
**********************************IHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHY***********************************************************************
******************************YDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAH************************NLRLVHSTEGLTMMP************************EIEVEVEKLLKI*
************KNPNNVQNPNRKENQDVEYDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHY**********RLSARLKKRNLRLVHSTEGLTMMPQPSNEQMRVKARKRNGHGEANTSVEIEVEVEKLLKID
*****V**KNPGKNPNN*QN***KENQDVEYDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHYKYETSAERKRRLSARLKKRNLRLVHSTEGLTMMPQPSNEQMRVKARKRNGHGEANTSVEIEVEVEKLLKID
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KGKTHVQDKNPGKNPNNVQNPNRKENQDVEYDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHYKYETSAERKRRLSARLKKRNLRLVHSTEGLTMMPQPSNEQMRVKARKRNGHGEANTSVEIEVEVEKLLKID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
255574424 475 hypothetical protein RCOM_0146500 [Ricin 0.707 0.208 0.472 2e-21
356536552 325 PREDICTED: uncharacterized protein LOC10 0.542 0.233 0.610 1e-19
255647072 325 unknown [Glycine max] 0.542 0.233 0.610 1e-19
297836188 330 zinc finger family protein [Arabidopsis 0.542 0.230 0.610 2e-18
91805447 301 zinc finger family protein [Arabidopsis 0.492 0.229 0.608 6e-17
15224184 251 C2H2-like zinc finger protein [Arabidops 0.492 0.274 0.608 6e-17
116830465 302 unknown [Arabidopsis thaliana] 0.492 0.228 0.608 6e-17
297795231 297 hypothetical protein ARALYDRAFT_917478 [ 0.514 0.242 0.597 1e-16
297791759 297 hypothetical protein ARALYDRAFT_917489 [ 0.514 0.242 0.597 1e-16
297832510 333 hypothetical protein ARALYDRAFT_900233 [ 0.464 0.195 0.646 2e-16
>gi|255574424|ref|XP_002528125.1| hypothetical protein RCOM_0146500 [Ricinus communis] gi|223532464|gb|EEF34255.1| hypothetical protein RCOM_0146500 [Ricinus communis] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (64%), Gaps = 11/110 (10%)

Query: 28  DVEYDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHYKYETSAERKRRLSARLKK 87
           D E DGR HS P +KYGPY CPKC   F  SQ FAAHM +HYK E+S +RK+RL+A+ K+
Sbjct: 294 DTEDDGRTHSLPHEKYGPYTCPKCRNVFSVSQTFAAHMLTHYKNESSDQRKKRLAAKYKR 353

Query: 88  RNLRLVHSTEGLTMMPQPS-----------NEQMRVKARKRNGHGEANTS 126
           +NLRLV+   G+T++P+ S           N  +R + ++  G+ EA TS
Sbjct: 354 KNLRLVYRRGGMTLLPESSKARGKSVNMVDNSNVRNEVQEGQGNAEATTS 403




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356536552|ref|XP_003536801.1| PREDICTED: uncharacterized protein LOC100788426 [Glycine max] Back     alignment and taxonomy information
>gi|255647072|gb|ACU24004.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297836188|ref|XP_002885976.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297331816|gb|EFH62235.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|91805447|gb|ABE65452.1| zinc finger family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15224184|ref|NP_179439.1| C2H2-like zinc finger protein [Arabidopsis thaliana] gi|4218009|gb|AAD12217.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana] gi|225898116|dbj|BAH30390.1| hypothetical protein [Arabidopsis thaliana] gi|330251680|gb|AEC06774.1| C2H2-like zinc finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|116830465|gb|ABK28190.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297795231|ref|XP_002865500.1| hypothetical protein ARALYDRAFT_917478 [Arabidopsis lyrata subsp. lyrata] gi|297311335|gb|EFH41759.1| hypothetical protein ARALYDRAFT_917478 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297791759|ref|XP_002863764.1| hypothetical protein ARALYDRAFT_917489 [Arabidopsis lyrata subsp. lyrata] gi|297309599|gb|EFH40023.1| hypothetical protein ARALYDRAFT_917489 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297832510|ref|XP_002884137.1| hypothetical protein ARALYDRAFT_900233 [Arabidopsis lyrata subsp. lyrata] gi|297329977|gb|EFH60396.1| hypothetical protein ARALYDRAFT_900233 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
TAIR|locus:2046318251 AT2G18490 "AT2G18490" [Arabido 0.457 0.254 0.406 6.3e-07
TAIR|locus:2053598329 AT2G15740 "AT2G15740" [Arabido 0.385 0.164 0.509 1.5e-06
TAIR|locus:2163857300 AT5G42640 "AT5G42640" [Arabido 0.435 0.203 0.419 2e-05
TAIR|locus:2172716324 AT5G22990 "AT5G22990" [Arabido 0.357 0.154 0.450 0.00022
TAIR|locus:2046318 AT2G18490 "AT2G18490" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 118 (46.6 bits), Expect = 6.3e-07, P = 6.3e-07
 Identities = 26/64 (40%), Positives = 32/64 (50%)

Query:    13 KNPNNVQNPNRKENQDVEYDGRIHSHXXXXXXXXXXXXXNGAFGTSQAFAAHMRSHYKYE 72
             K    +     +++ D +YDGRIHS              N  F TSQ FAAHM SHYK E
Sbjct:   136 KTTEYIDCEENEKSDDAQYDGRIHSLPYKKYGPYTCPKCNSIFDTSQKFAAHMSSHYKSE 195

Query:    73 TSAE 76
             T+ E
Sbjct:   196 TNKE 199




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2053598 AT2G15740 "AT2G15740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163857 AT5G42640 "AT5G42640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172716 AT5G22990 "AT5G22990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
scaffold_303767.1
annotation not avaliable (330 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.25
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.02
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 98.75
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.61
KOG3576267 consensus Ovo and related transcription factors [T 98.46
KOG1074958 consensus Transcriptional repressor SALM [Transcri 98.27
KOG3576267 consensus Ovo and related transcription factors [T 98.25
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 98.22
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 98.2
PHA0061644 hypothetical protein 98.02
PHA0276855 hypothetical protein; Provisional 97.67
PHA0276855 hypothetical protein; Provisional 97.55
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.37
KOG3608 467 consensus Zn finger proteins [General function pre 97.17
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.04
PHA00733128 hypothetical protein 96.71
KOG3608467 consensus Zn finger proteins [General function pre 96.59
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.57
PHA00733128 hypothetical protein 96.45
smart0035526 ZnF_C2H2 zinc finger. 96.31
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.16
PHA0073279 hypothetical protein 95.81
PLN03086567 PRLI-interacting factor K; Provisional 95.58
COG5189423 SFP1 Putative transcriptional repressor regulating 95.13
PHA0073279 hypothetical protein 95.01
PLN03086567 PRLI-interacting factor K; Provisional 95.01
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.33
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.58
KOG3993 500 consensus Transcription factor (contains Zn finger 93.1
PHA0061644 hypothetical protein 92.49
PRK04860160 hypothetical protein; Provisional 91.73
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 90.44
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.42
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 90.42
COG5048467 FOG: Zn-finger [General function prediction only] 90.12
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 89.54
PRK04860160 hypothetical protein; Provisional 86.16
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 81.07
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.25  E-value=2.6e-12  Score=100.71  Aligned_cols=64  Identities=20%  Similarity=0.304  Sum_probs=56.4

Q ss_pred             CCCCCCcCCCCchHHHHhhhhcCCCCCCccccccccCcccCCchhHhhhcccccCCCChHHHHHHHHH
Q 044394           16 NNVQNPNRKENQDVEYDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHYKYETSAERKRRLSA   83 (140)
Q Consensus        16 ~~~~~~~~~k~s~L~~H~r~Htg~h~~ekP~~C~~Cgk~F~~~~~L~~H~r~Ht~ekp~~~~~~~~~~   83 (140)
                      +.||.+.|.+..-|+-|+|+|||    ||||.|+.|+|+|..+++|..|+++|.+.|+|+|..+...+
T Consensus       190 C~iCGKaFSRPWLLQGHiRTHTG----EKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsF  253 (279)
T KOG2462|consen  190 CGICGKAFSRPWLLQGHIRTHTG----EKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSF  253 (279)
T ss_pred             cccccccccchHHhhcccccccC----CCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHH
Confidence            46778889888899999999999    99999999999999999999999999999999876554333



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.42
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.22
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.16
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.1
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.06
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.03
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.02
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.01
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.0
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.0
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.99
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.98
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.98
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.97
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.97
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.97
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.97
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.96
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 98.96
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.95
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.94
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.93
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.92
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.92
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.92
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.91
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.9
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.89
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.87
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.86
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.86
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.84
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.84
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.84
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.82
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.82
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.82
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.82
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 98.81
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.81
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.8
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.8
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.79
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.78
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.78
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.77
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.77
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.75
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.74
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.74
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.73
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.73
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 98.73
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.73
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.72
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.72
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.68
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.68
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.68
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.67
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.67
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.67
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.65
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.65
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.64
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.63
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.61
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.61
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.6
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.58
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.57
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.55
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.55
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.54
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.52
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.52
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.52
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.49
1tf6_A190 Protein (transcription factor IIIA); complex (tran 98.48
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.45
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.45
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.45
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.45
1tf6_A190 Protein (transcription factor IIIA); complex (tran 98.45
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.45
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.44
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.42
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.42
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.41
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 98.4
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.4
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.39
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.39
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.38
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.38
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.36
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.33
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.33
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.32
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.32
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.32
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.65
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.3
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.3
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.63
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.29
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.28
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.28
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.27
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.27
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.26
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.25
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.25
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.25
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.24
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.23
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.22
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.09
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.37
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.03
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.0
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.98
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 97.98
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 97.93
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.91
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.9
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.89
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.89
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 97.88
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 97.88
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.87
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.86
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 97.85
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.84
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.84
2epa_A72 Krueppel-like factor 10; transforming growth facto 97.83
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.83
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.82
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.82
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.82
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.82
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.81
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.81
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 97.81
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.78
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.78
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 97.78
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.78
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 97.77
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.76
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 97.75
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 97.74
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.74
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.74
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.74
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 97.74
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.73
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.72
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.72
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.72
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.69
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.69
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.69
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.69
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.67
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.67
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.67
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 97.67
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.67
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.66
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.66
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.65
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 97.65
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.64
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.64
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.63
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 97.61
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.6
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.54
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 97.52
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.52
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.51
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.49
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.47
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.45
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.43
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.42
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.39
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.36
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.35
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.35
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.34
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 97.32
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.31
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.31
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 97.3
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.29
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 97.28
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.27
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.27
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.26
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 97.25
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 97.25
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.21
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 97.21
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.2
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 97.2
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.2
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.19
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.17
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.17
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 97.15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 97.15
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 97.14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 97.11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 97.09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 97.08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 97.08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 97.07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 97.06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 97.03
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 96.98
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.94
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.94
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 96.9
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.9
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.87
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 96.83
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.81
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 96.65
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 96.55
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 96.46
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 96.44
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.0
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 95.45
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 95.34
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.23
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 95.04
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 94.95
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 94.69
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 94.68
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.67
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 94.26
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.13
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 93.91
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 93.91
1ard_A29 Yeast transcription factor ADR1; transcription reg 93.85
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 93.64
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 93.63
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.3
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 93.01
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.95
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 92.72
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.69
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.55
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.53
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 92.41
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.01
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 92.0
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.75
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 91.61
1paa_A30 Yeast transcription factor ADR1; transcription reg 91.59
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 91.11
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 90.66
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 89.8
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 88.31
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 81.91
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.42  E-value=7.7e-14  Score=85.89  Aligned_cols=52  Identities=21%  Similarity=0.477  Sum_probs=49.0

Q ss_pred             CCCCCcCCCCchHHHHhhhhcCCCCCCccccccccCcccCCchhHhhhcccccCCC
Q 044394           17 NVQNPNRKENQDVEYDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHYKYE   72 (140)
Q Consensus        17 ~~~~~~~~k~s~L~~H~r~Htg~h~~ekP~~C~~Cgk~F~~~~~L~~H~r~Ht~ek   72 (140)
                      .+|...|...+.|..|+++|++    ++||.|..|+++|.+...|..|+++|+|++
T Consensus         8 ~~C~k~F~~~~~L~~H~~~Ht~----ekp~~C~~C~k~F~~~~~L~~H~~~Htgep   59 (60)
T 4gzn_C            8 NFCGKTYRDASGLSRHRRAHLG----YRPRSCPECGKCFRDQSEVNRHLKVHQNKP   59 (60)
T ss_dssp             TTTCCEESSHHHHHHHHHHHHT----CCCEECTTTCCEESSHHHHHHHGGGGSCC-
T ss_pred             CCCCCEeCCHHHHHHHHHHhCC----CcCeECCCCCCCcCCHHHHHHHhCccCCCC
Confidence            5678999999999999999999    999999999999999999999999999975



>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 9e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.003
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.004
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 32.8 bits (75), Expect = 9e-04
 Identities = 9/25 (36%), Positives = 12/25 (48%)

Query: 46 YKCPKCNGAFGTSQAFAAHMRSHYK 70
          Y C  C   F ++QA   HM  H +
Sbjct: 6  YTCSFCKREFRSAQALGGHMNVHRR 30


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.32
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.2
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.2
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.16
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.12
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.08
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.07
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.06
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.97
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.88
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.74
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.72
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.68
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.67
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.52
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.49
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.4
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.36
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.13
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.04
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.92
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.74
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.45
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.33
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.29
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.23
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.22
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.21
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.19
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.18
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.98
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.97
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.93
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.9
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.81
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.73
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.69
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.68
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.67
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.43
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 96.35
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.17
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.16
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.89
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 95.88
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.69
d2cota238 Zinc finger and SCAN domain-containing protein 16, 95.63
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 95.4
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.34
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.3
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 95.1
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 94.86
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.81
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.69
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 94.66
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 94.29
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.12
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.9
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.18
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 92.71
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.64
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.54
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.28
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.71
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 91.4
d1y0jb136 U-shaped transcription factor, different fingers { 86.07
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 84.63
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.5
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 83.01
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 82.66
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger and SCAN domain-containing protein 16, ZSCAN16
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.32  E-value=1.4e-13  Score=76.16  Aligned_cols=37  Identities=24%  Similarity=0.449  Sum_probs=34.7

Q ss_pred             HHhhhhcCCCCCCccccccccCcccCCchhHhhhcccccCC
Q 044394           31 YDGRIHSHPCKKYGPYKCPKCNGAFGTSQAFAAHMRSHYKY   71 (140)
Q Consensus        31 ~H~r~Htg~h~~ekP~~C~~Cgk~F~~~~~L~~H~r~Ht~e   71 (140)
                      +|+++|++    ++||.|..||++|.+.+.|..|+++|+||
T Consensus         2 rH~~~Ht~----ekpy~C~~CgK~F~~~s~L~~H~r~HtGE   38 (38)
T d2cota2           2 RSEWQQRE----RRRYKCDECGKSFSHSSDLSKHRRTHTGE   38 (38)
T ss_dssp             CCCSCCCC----SCSSBCSSSCCBCSCHHHHHHHHTTTCCS
T ss_pred             ccCcccCC----CCCEecCCCCceeeCHHHHHHhCccCCCC
Confidence            47788888    99999999999999999999999999996



>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure