Citrus Sinensis ID: 044426

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MENRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNNKLRSKDLFPTDIHSILKEKLSLGTWVSYFKEEAWFDFENNKENNNEGTIIAKTSPSSWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPFGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSISCIQDLWYLKKVNCVADDNKEERMMMEQFGNVFVDPREF
ccccEEEEEccccccHHHHHHHHHHHccccccccEEEEccccccHHHHccccccEEEEEEEcccccEEEEEEEEEEcccccccccEEEEEEEEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHcccccccccEEEEEEccccccccccccccEEcccHHHHHHHHHccccccccccccHHHHHHccccccEEEEEEEcccccccccccccccccccccccccccEEEEEEEccccEEEEEEcccccHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccccccccccEEEEEEcccccccccHHHccccccccEEEccccc
cccEEEEEEccHHHHHHHHHHHHHHcccccccccEEEEccccccHHEEcccccEEEEEEEEccccEEEEEEEEEEEEEEccccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccccccccEEEEcccccccccccccEEEEEccHHHHHHHHHHHccccccccHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccEEEEEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHccccccHcccHHHHHHHHHccccccccccccccccccccEEEccccc
MENRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTnmttdplcriRFYAVHVMLVAELRENGELVGVVRGcikgvgtkfEGQIVKLGCILglrvsprhrrmgigFHLVKSVEEWLMRNGAHYTFLAteknnvastnlftsrcnymnfssLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNnklrskdlfptDIHSILKEKLSLGTWVSYFKEeawfdfennkennnegtiiaktspsswvMFSIWNSCEaykihkskshnpfFKFLHATLShakvkifpcigvrmpigsslgnpfGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITelgvsdpliqhvpressisciqdlwyLKKVNCVADDNKEERMMMEQfgnvfvdpref
menrvlirefneardvevvgklekkceigskngvaLFTNMTTDPLCRIRFYAVHVMLVAELrengelvgVVRGCIKGvgtkfegqivKLGCILGlrvsprhrrMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNNklrskdlfPTDIHSILKEKLSLGTWVSYFKEEAWFDFENNKENNnegtiiaktspssWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPFGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSisciqdlwylkKVNCVADDNKEERMMMEqfgnvfvdpref
MENRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNNKLRSKDLFPTDIHSILKEKLSLGTWVSYFKEEAWFDFennkennneGTIIAKTSPSSWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPfgflflyglygegerlgelMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSISCIQDLWYLKKVNCVADDNKEERMMMEQFGNVFVDPREF
*****LIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNNKLRSKDLFPTDIHSILKEKLSLGTWVSYFKEEAWFDFENNKENNNEGTIIAKTSPSSWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPFGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSISCIQDLWYLKKVNCVAD**********************
**NRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQ*IKIEKLQIDQAISLYNNKLRSKDLFPTDIHSILKEKLSLGTWVSYFKEEAWFDFENNKENNNEGTIIAKTSPSSWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPFGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSISCIQDLWYLKKVNCVADDNKE**MMMEQFGNVFVDPREF
MENRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNNKLRSKDLFPTDIHSILKEKLSLGTWVSYFKEEAWFDFENNKENNNEGTIIAKTSPSSWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPFGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSISCIQDLWYLKKVNCVADDNKEERMMMEQFGNVFVDPREF
*ENRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNNKLRSKDLFPTDIHSILKEKLSLGTWVSYFKEEAW**FENNKE****GTIIAKTSPSSWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPFGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSISCIQDLWYLKKVNC*****KEERMMMEQFGNVFVD*R*F
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNNKLRSKDLFPTDIHSILKEKLSLGTWVSYFKEEAWFDFENNKENNNEGTIIAKTSPSSWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPFGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSISCIQDLWYLKKVNCVADDNKEERMMMEQFGNVFVDPREF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
224108719397 predicted protein [Populus trichocarpa] 0.982 0.987 0.735 1e-168
255556374399 N-acetyltransferase, putative [Ricinus c 0.989 0.989 0.699 1e-163
225431950403 PREDICTED: uncharacterized protein LOC10 0.977 0.967 0.609 1e-138
356564810402 PREDICTED: uncharacterized protein LOC10 0.987 0.980 0.598 1e-136
296083249417 unnamed protein product [Vitis vinifera] 0.917 0.877 0.618 1e-132
356519928400 PREDICTED: uncharacterized protein LOC10 0.982 0.98 0.591 1e-129
356529165398 PREDICTED: uncharacterized protein LOC10 0.984 0.987 0.570 1e-129
449433437415 PREDICTED: uncharacterized protein LOC10 0.964 0.927 0.535 1e-107
449516900414 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.964 0.929 0.529 1e-105
357478967350 hypothetical protein MTR_4g122030 [Medic 0.839 0.957 0.485 3e-95
>gi|224108719|ref|XP_002314944.1| predicted protein [Populus trichocarpa] gi|222863984|gb|EEF01115.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  596 bits (1536), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 294/400 (73%), Positives = 337/400 (84%), Gaps = 8/400 (2%)

Query: 1   MENRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAE 60
           +EN+V+IRE+NE RD++VVGKLE+KCEIGS   V++FTNM  DPL RIRFY VHVMLVAE
Sbjct: 5   IENKVVIREYNEDRDIKVVGKLERKCEIGSNKEVSIFTNMMGDPLSRIRFYPVHVMLVAE 64

Query: 61  LRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMR 120
           LRENGELVGVV+GCIK VGT+F    V+LGCILGLRVSPRHRRMGIG  LVKSVEEWL+ 
Sbjct: 65  LRENGELVGVVKGCIKCVGTRFGASYVRLGCILGLRVSPRHRRMGIGLELVKSVEEWLIG 124

Query: 121 NGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQ 180
           NGAHYTFLATEKNNVASTNLFTS+CNYMNF+SL IFVQP SL +K LSQDIKIEKLQ DQ
Sbjct: 125 NGAHYTFLATEKNNVASTNLFTSKCNYMNFTSLVIFVQPASLPVKGLSQDIKIEKLQTDQ 184

Query: 181 AISLYNNKLRSKDLFPTDIHSILKEKLSLGTWVSYFKEEAWFDFENNKENNNEGTIIAKT 240
           AI LYNNK +SKD++PTD+ +ILKEKLS+GTWVSYFKEE W    +N+ N +   II +T
Sbjct: 185 AIYLYNNKFKSKDIYPTDVDAILKEKLSIGTWVSYFKEEEWITLHSNERNED---IITRT 241

Query: 241 SPSSWVMFSIWNSCEAYKIHKSKSHNPFFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNP 300
            PSSW MFSIWNSCEAYK+H  KSH+P FKF HATLSHA+ KIFPC+  + PI  SL  P
Sbjct: 242 -PSSWAMFSIWNSCEAYKLHIRKSHHP-FKFFHATLSHARDKIFPCL--KFPICHSLQKP 297

Query: 301 FGFLFLYGLYGEGERLGELMKSVLSFASRLAENFKHCKMIITELGVSDPLIQHVPRESSI 360
           FGFLFL+GLYGEGERL ELMKS+ SFASRLAEN K CK+II+ELGVSDPLI+HVP+ESS+
Sbjct: 298 FGFLFLFGLYGEGERLQELMKSIWSFASRLAENVKDCKVIISELGVSDPLIEHVPQESSM 357

Query: 361 SCIQDLWYLKKVN-CVADDNKEERMMMEQFGNVFVDPREF 399
           S I DLWYLKKVN  + DDN+E  +M +  GNVFVDPR+F
Sbjct: 358 SFINDLWYLKKVNDNITDDNEEPVVMGQVTGNVFVDPRDF 397

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255556374|ref|XP_002519221.1| N-acetyltransferase, putative [Ricinus communis] gi|223541536|gb|EEF43085.1| N-acetyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225431950|ref|XP_002272537.1| PREDICTED: uncharacterized protein LOC100241472 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356564810|ref|XP_003550641.1| PREDICTED: uncharacterized protein LOC100814448 [Glycine max] Back     alignment and taxonomy information
>gi|296083249|emb|CBI22885.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519928|ref|XP_003528620.1| PREDICTED: uncharacterized protein LOC100792925 [Glycine max] Back     alignment and taxonomy information
>gi|356529165|ref|XP_003533167.1| PREDICTED: uncharacterized protein LOC100808694 [Glycine max] Back     alignment and taxonomy information
>gi|449433437|ref|XP_004134504.1| PREDICTED: uncharacterized protein LOC101215331 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516900|ref|XP_004165484.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224574 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357478967|ref|XP_003609769.1| hypothetical protein MTR_4g122030 [Medicago truncatula] gi|355510824|gb|AES91966.1| hypothetical protein MTR_4g122030 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
TAIR|locus:2045329413 AT2G23060 "AT2G23060" [Arabido 0.761 0.736 0.306 6.1e-54
TAIR|locus:2005512403 HLS1 "AT4G37580" [Arabidopsis 0.967 0.957 0.332 3e-53
TAIR|locus:2060874386 AT2G30090 [Arabidopsis thalian 0.528 0.546 0.433 1.1e-48
TAIR|locus:2158172386 AT5G67430 [Arabidopsis thalian 0.596 0.616 0.388 2e-47
TAIR|locus:2045329 AT2G23060 "AT2G23060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 396 (144.5 bits), Expect = 6.1e-54, Sum P(2) = 6.1e-54
 Identities = 96/313 (30%), Positives = 153/313 (48%)

Query:    88 KLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNY 147
             KL  ILGLRVSP HRR GIGF LVK++E+W  +NGA Y++ ATE +N AS NLFT +C Y
Sbjct:   109 KLAYILGLRVSPTHRRQGIGFKLVKAMEDWFSQNGAEYSYFATENDNHASVNLFTGKCGY 168

Query:   148 MNFSSLFIFVQPVSLSLKVLSQDIKIEKLQIDQAISLYNNKLRSKDLFPTDIHSILKEKL 207
               F +  I V PV      +S+ + + KL+   A  LY  +  + + FP DI S+L  KL
Sbjct:   169 AEFRTPSILVNPVYAHRVNISRRVTVIKLEPSDAELLYRLRFSTTEFFPRDIDSVLNNKL 228

Query:   208 SLGTWVSYFKEEAWFDFXXXXXXXXXGTIIAKTSPSSWVMFSIWNSCEAYKIHKSKSHNP 267
             SLGT+V+  +      +              +  P SW + S+WN  +++++    +   
Sbjct:   229 SLGTFVAVPRGSC---YGSGSRSWPGSAKFLEYPPDSWAVLSVWNCKDSFRLEVRGASR- 284

Query:   268 FFKFLHATLSHAKVKIFPCIGVRMPIGSSLGNPXXXXXXXXXXXXXXXXXXXMKSVLSFA 327
               + + +  +    K  P +  ++P   ++  P                   +K++   A
Sbjct:   285 -LRRVVSKATRMVDKTLPFL--KIPSIPAVFRPFGLHFMYGIGGEGPRAEKMVKALCDHA 341

Query:   328 SRLAENFKHCKMIITELGVSDPLIQHVPRESSISCIQDLWYLKKVNCVADDNKEERMMME 387
               LA+    C ++  E+   +PL + +P    +SC +DLW +K++     D         
Sbjct:   342 HNLAKE-GGCGVVAAEVAGEEPLRRGIPHWKVLSCAEDLWCIKRLGEDYSDGSVGDWTKS 400

Query:   388 QFGN-VFVDPREF 399
               G+ +FVDPREF
Sbjct:   401 PPGDSIFVDPREF 413
GO:0005575 "cellular_component" evidence=ND
GO:0008080 "N-acetyltransferase activity" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=ISS
TAIR|locus:2005512 HLS1 "AT4G37580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060874 AT2G30090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158172 AT5G67430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00101386
hypothetical protein (397 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
pfam0058380 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT 1e-12
cd0430165 cd04301, NAT_SF, N-Acyltransferase superfamily: Va 5e-08
COG0456177 COG0456, RimI, Acetyltransferases [General functio 5e-04
TIGR03103547 TIGR03103, trio_acet_GNAT, GNAT-family acetyltrans 0.003
>gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family Back     alignment and domain information 
 Score = 62.7 bits (153), Expect = 1e-12
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 7/83 (8%)

Query: 61  LRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMR 120
             E+GELVG               +   +  I GL V P +R  GIG  L++++EE+   
Sbjct: 1   AEEDGELVGFASL-------SIIDEEGNVAEIEGLAVDPEYRGKGIGTALLEALEEYARE 53

Query: 121 NGAHYTFLATEKNNVASTNLFTS 143
            G     L   ++N A+  L+  
Sbjct: 54  LGLKRIELEVLEDNEAAIALYEK 76

This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins. Length = 80
>gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>gnl|CDD|223532 COG0456, RimI, Acetyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|132147 TIGR03103, trio_acet_GNAT, GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 399
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.67
PTZ00330147 acetyltransferase; Provisional 99.63
PRK03624140 putative acetyltransferase; Provisional 99.63
PRK01346411 hypothetical protein; Provisional 99.62
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.59
KOG3216163 consensus Diamine acetyltransferase [Amino acid tr 99.58
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 99.58
PRK10140162 putative acetyltransferase YhhY; Provisional 99.56
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 99.56
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 99.56
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 99.56
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 99.55
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 99.54
COG0456177 RimI Acetyltransferases [General function predicti 99.53
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 99.52
PHA00673154 acetyltransferase domain containing protein 99.51
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 99.51
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 99.51
KOG3139165 consensus N-acetyltransferase [General function pr 99.5
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 99.49
PRK07922169 N-acetylglutamate synthase; Validated 99.48
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 99.45
PRK07757152 acetyltransferase; Provisional 99.44
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 99.43
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 99.42
COG1247169 Sortase and related acyltransferases [Cell envelop 99.4
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.38
PRK10514145 putative acetyltransferase; Provisional 99.37
PRK15130186 spermidine N1-acetyltransferase; Provisional 99.35
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 99.33
COG3153171 Predicted acetyltransferase [General function pred 99.33
PRK10562145 putative acetyltransferase; Provisional 99.32
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 99.32
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 99.31
PLN02825515 amino-acid N-acetyltransferase 99.3
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 99.29
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 99.29
KOG3235193 consensus Subunit of the major N alpha-acetyltrans 99.27
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 99.27
KOG3396150 consensus Glucosamine-phosphate N-acetyltransferas 99.27
PRK05279441 N-acetylglutamate synthase; Validated 99.26
PHA01807153 hypothetical protein 99.26
PRK09831147 putative acyltransferase; Provisional 99.26
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 99.25
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 99.25
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 99.24
PRK10314153 putative acyltransferase; Provisional 99.21
KOG3234173 consensus Acetyltransferase, (GNAT) family [Genera 99.18
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 98.99
PRK13688156 hypothetical protein; Provisional 98.95
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 98.93
KOG3138187 consensus Predicted N-acetyltransferase [General f 98.85
COG3393268 Predicted acetyltransferase [General function pred 98.78
KOG2488202 consensus Acetyltransferase (GNAT) domain-containi 98.78
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 98.67
COG3981174 Predicted acetyltransferase [General function pred 98.67
COG1670187 RimL Acetyltransferases, including N-acetylases of 98.67
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 98.45
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 98.44
KOG3397225 consensus Acetyltransferases [General function pre 98.42
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 98.4
COG2153155 ElaA Predicted acyltransferase [General function p 98.39
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 98.26
COG3818167 Predicted acetyltransferase, GNAT superfamily [Gen 98.19
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 98.15
KOG4135185 consensus Predicted phosphoglucosamine acetyltrans 97.98
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 97.93
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 97.87
KOG4144190 consensus Arylalkylamine N-acetyltransferase [Gene 97.81
COG4552389 Eis Predicted acetyltransferase involved in intrac 97.75
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 97.7
PF04958342 AstA: Arginine N-succinyltransferase beta subunit; 97.53
COG238899 Predicted acetyltransferase [General function pred 97.48
COG3375266 Uncharacterized conserved protein [Function unknow 97.45
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 97.45
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 97.42
PF06852181 DUF1248: Protein of unknown function (DUF1248); In 97.25
PRK10456344 arginine succinyltransferase; Provisional 97.21
COG3053352 CitC Citrate lyase synthetase [Energy production a 96.74
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 96.61
TIGR03243335 arg_catab_AOST arginine and ornithine succinyltran 96.59
TIGR03245336 arg_AOST_alph arginine/ornithine succinyltransfera 96.57
TIGR03694241 exosort_acyl putative PEP-CTERM/exosortase system- 96.49
TIGR03244336 arg_catab_AstA arginine N-succinyltransferase. In 96.48
PF01233162 NMT: Myristoyl-CoA:protein N-myristoyltransferase, 96.3
PF00765182 Autoind_synth: Autoinducer synthetase; InterPro: I 96.24
PF05301120 Mec-17: Touch receptor neuron protein Mec-17; Inte 96.13
PRK13834207 putative autoinducer synthesis protein; Provisiona 96.12
COG5628143 Predicted acetyltransferase [General function pred 95.92
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 95.39
COG3138336 AstA Arginine/ornithine N-succinyltransferase beta 94.76
TIGR03019330 pepcterm_femAB FemAB-related protein, PEP-CTERM sy 94.27
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 93.18
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 93.12
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 92.29
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 92.13
PF09390161 DUF1999: Protein of unknown function (DUF1999); In 92.04
COG3916209 LasI N-acyl-L-homoserine lactone synthetase [Signa 90.65
cd0426499 DUF619-NAGS DUF619 domain of various N-acetylgluta 90.57
KOG3698891 consensus Hyaluronoglucosaminidase [Posttranslatio 89.9
PRK14852 989 hypothetical protein; Provisional 89.2
PRK01305240 arginyl-tRNA-protein transferase; Provisional 88.6
KOG2535554 consensus RNA polymerase II elongator complex, sub 88.23
KOG2779421 consensus N-myristoyl transferase [Lipid transport 87.76
KOG4601264 consensus Uncharacterized conserved protein [Funct 87.73
PF13444101 Acetyltransf_5: Acetyltransferase (GNAT) domain 86.1
cd0426599 DUF619-NAGS-U DUF619 domain of various N-acetylglu 85.19
PF04377128 ATE_C: Arginine-tRNA-protein transferase, C termin 82.01
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 81.88
PF04768170 DUF619: Protein of unknown function (DUF619); Inte 80.78
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 80.41
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information 
Probab=99.67  E-value=1e-15  Score=132.47  Aligned_cols=136  Identities=21%  Similarity=0.139  Sum_probs=101.5

Q ss_pred             cceEEEEcCCcchHHHHHHHHHHhccCCCchhHHHHHHhcChhhhhhccCceEEEEEEECCCCCEEEEEEEEEeccCccc
Q 044426            3 NRVLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTKF   82 (399)
Q Consensus         3 ~~~~IR~~~~~~Dl~~v~~L~~~~e~~~~~~~~~~~~~l~dpl~ri~~~p~~~~lVAe~~~~geiVG~i~~~i~~~~~~~   82 (399)
                      +++.||+++ .+|++.+.++......... ......+.+.+    ....+...++|++.+  +++||++.+......   
T Consensus         2 ~~~~ir~a~-~~D~~~l~~l~~~~~~~~~-~~~~~~~~~~~----~l~~~~~~~~v~~~~--~~ivG~~~~~~~~~~---   70 (144)
T PRK10146          2 PACELRPAT-QYDTDAVYALICELKQAEF-DHQAFRVGFNA----NLRDPNMRYHLALLD--GEVVGMIGLHLQFHL---   70 (144)
T ss_pred             CccEEeeCc-HhhHHHHHHHHHHHhcccC-CHHHHHHHHHH----HhcCCCceEEEEEEC--CEEEEEEEEEecccc---
Confidence            578999999 9999999999876532111 11111111111    111233566788887  899999988653211   


Q ss_pred             cccccceEEEEEEEEccCcccchHHHHHHHHHHHHHHHCCCcEEEEEEecCCHHHHHHHHHhCCCEEEe
Q 044426           83 EGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFS  151 (399)
Q Consensus        83 ~~~~~~~ayI~~l~V~P~~RgrGIG~~Ll~~~~e~~~~~G~~~i~l~v~~~N~aa~~lyy~k~GF~~~~  151 (399)
                       ......++|..++|+|+|||+|||++|++.+++++++.|+..+.+.+...|..|++|| +|+||....
T Consensus        71 -~~~~~~~~i~~l~v~p~~rg~GiG~~Ll~~~~~~a~~~~~~~i~l~~~~~n~~a~~fY-~~~Gf~~~~  137 (144)
T PRK10146         71 -HHVNWIGEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFY-LREGYEQSH  137 (144)
T ss_pred             -cccchhheeheeEECHHHcCCCHHHHHHHHHHHHHHHcCCcEEEEecCCCchHHHHHH-HHcCCchhh
Confidence             1122346788999999999999999999999999999999999999999999999997 999998664

>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>KOG3139 consensus N-acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>KOG3396 consensus Glucosamine-phosphate N-acetyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>KOG3234 consensus Acetyltransferase, (GNAT) family [General function prediction only] Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>KOG3397 consensus Acetyltransferases [General function prediction only] Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>KOG4135 consensus Predicted phosphoglucosamine acetyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>KOG4144 consensus Arylalkylamine N-acetyltransferase [General function prediction only] Back     alignment and domain information
>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>COG3375 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans Back     alignment and domain information
>PRK10456 arginine succinyltransferase; Provisional Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits Back     alignment and domain information
>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit Back     alignment and domain information
>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information
>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth Back     alignment and domain information
>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PF09390 DUF1999: Protein of unknown function (DUF1999); InterPro: IPR018987 This family contains a putative Fe-S binding reductase (Q72J89 from SWISSPROT) whose structure adopts an alpha and beta fold Back     alignment and domain information
>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish Back     alignment and domain information
>KOG3698 consensus Hyaluronoglucosaminidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK01305 arginyl-tRNA-protein transferase; Provisional Back     alignment and domain information
>KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2779 consensus N-myristoyl transferase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4601 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain Back     alignment and domain information
>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish Back     alignment and domain information
>PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 2e-13
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 6e-11
1vkc_A158 Putative acetyl transferase; structural genomics, 7e-11
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 5e-10
2aj6_A159 Hypothetical protein MW0638; structural genomics, 6e-10
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 3e-09
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 8e-09
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 9e-09
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 1e-08
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 1e-08
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 2e-08
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 4e-08
3mgd_A157 Predicted acetyltransferase; structural genomics, 2e-07
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 3e-07
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 4e-07
2ozg_A396 GCN5-related N-acetyltransferase; YP_325469.1, ace 5e-07
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 9e-07
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 1e-06
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 2e-06
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 2e-06
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 2e-06
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 2e-06
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 3e-06
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 3e-06
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 4e-06
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 4e-06
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 4e-06
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 4e-06
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 5e-06
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 5e-06
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 6e-06
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 8e-06
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 1e-05
1wwz_A159 Hypothetical protein PH1933; structural genomics, 1e-05
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 1e-05
2eui_A153 Probable acetyltransferase; dimer, structural geno 1e-05
3sxn_A422 Enhanced intracellular surviVal protein; GNAT fold 1e-05
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 1e-05
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 2e-05
2i6c_A160 Putative acetyltransferase; GNAT family, structura 4e-05
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 4e-05
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 5e-05
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 5e-05
3n7z_A388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 6e-05
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 6e-05
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 6e-05
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 6e-05
3kkw_A182 Putative uncharacterized protein; acetyltransferas 7e-05
2gan_A190 182AA long hypothetical protein; alpha-beta protei 7e-05
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 8e-05
2hv2_A400 Hypothetical protein; PSI, protein structure initi 1e-04
2i00_A406 Acetyltransferase, GNAT family; structural genomic 1e-04
1tiq_A180 Protease synthase and sporulation negative regulat 1e-04
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 1e-04
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 2e-04
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 2e-04
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 2e-04
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 2e-04
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 3e-04
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 3e-04
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 3e-04
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 4e-04
3r1k_A428 Enhanced intracellular surviVal protein; GNAT, ace 5e-04
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 6e-04
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 8e-04
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
 Score = 67.1 bits (164), Expect = 2e-13
 Identities = 23/141 (16%), Positives = 38/141 (26%), Gaps = 22/141 (15%)

Query: 5   VLIREFNEARDVEVVGKLEKKCEIGSKNGVALFTNMTTDPLCRIRFY--AVHVMLVAELR 62
           + IR    + D E+V  +  +           +            F+        +    
Sbjct: 2   MDIRTITSS-DYEMVTSVLNEW----------WGGRQLKEKLPRLFFEHFQDTSFITS-- 48

Query: 63  ENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNG 122
           E+  + G + G       +          I    V P  R+M IG  L     E + + G
Sbjct: 49  EHNSMTGFLIGFQSQSDPE-------TAYIHFSGVHPDFRKMQIGKQLYDVFIETVKQRG 101

Query: 123 AHYTFLATEKNNVASTNLFTS 143
                  T   N  S    T 
Sbjct: 102 CTRVKCVTSPVNKVSIAYHTK 122
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166 Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Length = 396 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187 Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157 Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166 Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228 Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Length = 330 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160 Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339 Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Length = 153 Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Length = 422 Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312 Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177 Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160 Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166 Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Length = 388 Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Length = 276 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 400 Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Length = 406 Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Length = 180 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 152 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174 Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172 Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} Length = 428 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.79
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.78
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 99.78
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.77
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.77
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.76
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 99.76
2ozg_A396 GCN5-related N-acetyltransferase; YP_325469.1, ace 99.76
1tiq_A180 Protease synthase and sporulation negative regulat 99.75
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.74
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 99.73
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 99.73
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.73
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 99.73
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 99.73
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.73
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 99.72
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.72
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 99.72
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 99.72
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 99.72
3kkw_A182 Putative uncharacterized protein; acetyltransferas 99.72
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 99.72
2eui_A153 Probable acetyltransferase; dimer, structural geno 99.72
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.72
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 99.71
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 99.71
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.71
2fe7_A166 Probable N-acetyltransferase; structural genomics, 99.71
2hv2_A400 Hypothetical protein; PSI, protein structure initi 99.71
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.7
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 99.7
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 99.7
3n7z_A388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 99.7
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 99.7
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 99.7
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 99.69
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 99.69
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 99.69
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 99.69
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.69
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 99.69
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 99.68
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 99.68
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 99.68
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 99.68
2i6c_A160 Putative acetyltransferase; GNAT family, structura 99.68
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 99.68
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 99.68
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 99.68
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 99.67
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.67
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 99.67
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 99.67
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 99.67
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 99.66
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.66
2i00_A406 Acetyltransferase, GNAT family; structural genomic 99.66
1y7r_A133 Hypothetical protein SA2161; structural genomics, 99.66
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 99.66
3owc_A188 Probable acetyltransferase; structural genomics, P 99.66
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.65
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 99.65
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.65
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 99.65
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 99.65
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 99.65
1vkc_A158 Putative acetyl transferase; structural genomics, 99.65
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 99.64
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 99.64
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 99.64
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 99.64
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.64
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 99.64
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 99.64
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 99.64
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 99.63
2aj6_A159 Hypothetical protein MW0638; structural genomics, 99.63
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 99.63
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 99.63
2fl4_A149 Spermine/spermidine acetyltransferase; structural 99.62
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 99.62
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 99.62
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 99.62
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 99.62
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 99.62
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 99.62
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 99.62
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 99.61
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.61
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 99.61
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 99.6
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 99.6
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 99.6
3juw_A175 Probable GNAT-family acetyltransferase; structural 99.6
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 99.6
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 99.6
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 99.59
1nsl_A184 Probable acetyltransferase; structural genomics, h 99.59
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 99.59
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 99.59
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 99.59
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 99.59
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 99.59
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 99.59
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 99.59
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 99.58
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 99.57
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 99.57
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 99.57
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 99.57
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.57
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 99.57
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 99.56
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 99.56
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 99.56
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 99.56
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.55
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 99.55
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 99.55
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 99.55
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 99.55
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 99.54
3sxn_A422 Enhanced intracellular surviVal protein; GNAT fold 99.54
2gan_A190 182AA long hypothetical protein; alpha-beta protei 99.54
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 99.53
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 99.52
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 99.51
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 99.51
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 99.51
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 99.49
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 99.49
2qml_A198 BH2621 protein; structural genomics, joint center 99.49
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 99.48
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 99.48
3r1k_A428 Enhanced intracellular surviVal protein; GNAT, ace 99.48
3frm_A254 Uncharacterized conserved protein; APC61048, staph 99.47
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 99.46
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 99.44
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 99.44
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 99.42
1z4r_A168 General control of amino acid synthesis protein 5- 99.41
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 99.39
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.38
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.36
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 99.34
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 99.34
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 99.3
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 99.27
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 99.25
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 99.15
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 99.05
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 98.9
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 98.86
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 98.48
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.4
1yle_A342 Arginine N-succinyltransferase, alpha chain; struc 98.31
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 98.14
1xmt_A103 Putative acetyltransferase; structural genomics, p 98.1
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 97.95
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 97.82
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 97.31
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 97.25
4hkf_A191 Alpha-tubulin N-acetyltransferase; tubulin acetylt 96.55
1iic_A422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 96.14
1iyk_A392 Myristoyl-COA:protein N-myristoyltransferase; HET: 96.03
4b5o_A200 Alpha-tubulin N-acetyltransferase; microtubules, c 95.97
3iu1_A383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 95.96
4h6u_A200 Alpha-tubulin N-acetyltransferase; tubulin acetylt 95.8
3frm_A254 Uncharacterized conserved protein; APC61048, staph 95.75
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 95.71
4b14_A385 Glycylpeptide N-tetradecanoyltransferase; malaria, 95.58
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 95.51
4gs4_A240 Alpha-tubulin N-acetyltransferase; acetyl coenzyme 95.34
1rxt_A496 Myristoyl-, glycylpeptide N-tetradecanoyltransfera 95.17
3gkr_A336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 94.94
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 93.7
2wuu_A421 N-myristoyltransferase; acyltransferase; HET: NHM; 92.97
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 90.84
1lrz_A426 FEMA, factor essential for expression of methicill 86.86
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 83.79
4ab7_A464 Protein Arg5,6, mitochondrial; transferase, argini 83.41
3kkw_A182 Putative uncharacterized protein; acetyltransferas 83.38
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 82.55
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 80.98
2ou2_A280 Histone acetyltransferase htatip; structural genom 80.6
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 80.21
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
Probab=99.79  E-value=1.4e-17  Score=144.79  Aligned_cols=143  Identities=15%  Similarity=0.186  Sum_probs=113.2

Q ss_pred             cceEEEEcCCcchHHHHHHHHHHhccCCCchh--HHHHHHhcChhhhhhccCceEEEEEEECCCCCEEEEEEEEEeccCc
Q 044426            3 NRVLIREFNEARDVEVVGKLEKKCEIGSKNGV--ALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGT   80 (399)
Q Consensus         3 ~~~~IR~~~~~~Dl~~v~~L~~~~e~~~~~~~--~~~~~~l~dpl~ri~~~p~~~~lVAe~~~~geiVG~i~~~i~~~~~   80 (399)
                      ..+.||+++ .+|++.+.+|....+.. ....  ..+...+.+        +...++|++.+  |++||++.+.......
T Consensus        20 ~~~~ir~~~-~~D~~~~~~l~~~~~~~-~~~~~~~~~~~~~~~--------~~~~~~v~~~~--~~~vG~~~~~~~~~~~   87 (166)
T 4evy_A           20 QGMNIKPAS-EASLKDWLELRNKLWSD-SEASHLQEMHQLLAE--------KYALQLLAYSD--HQAIAMLEASIRFEYV   87 (166)
T ss_dssp             CCEEEEECC-GGGHHHHHHHHHHHSCC-CHHHHHHHHHHHHTC--------TTEEEEEEEET--TEEEEEEEEEEECSCC
T ss_pred             CCcEEEECC-HHHHHHHHHHHHHHhcC-CchHHHHHHHHHhcC--------CCceEEEEEEC--CeEEEEEEEEeecccc
Confidence            468999999 99999999999887543 1111  112222222        34678899988  9999999887643221


Q ss_pred             cccccccceEEEEEEEEccCcccchHHHHHHHHHHHHHHHCCCcEEEEEEecCCHHHHHHHHHhCCCEEEeeeeEEeec
Q 044426           81 KFEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFVQP  159 (399)
Q Consensus        81 ~~~~~~~~~ayI~~l~V~P~~RgrGIG~~Ll~~~~e~~~~~G~~~i~l~v~~~N~aa~~lyy~k~GF~~~~t~~~~~~p  159 (399)
                      .. ......++|..++|+|+|||+|||++|++.+++++++.|+..+.+.+..+|.++++|| +|+||+..++...+..+
T Consensus        88 ~~-~~~~~~~~i~~~~V~p~~rg~Gig~~Ll~~~~~~a~~~g~~~i~l~~~~~N~~a~~~y-~k~GF~~~~~~~~~~~~  164 (166)
T 4evy_A           88 NG-TETSPVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMH-RSLGFQETEKVVYFSKK  164 (166)
T ss_dssp             TT-CSSSSEEEEEEEEECGGGTTSSHHHHHHHHHHHHHHHTTCCEEEEEEETTCHHHHHHH-HHTTCEEEEEEEEEEEE
T ss_pred             cC-CCCCCeEEEEEEEEChhhhcCCHHHHHHHHHHHHHHHcCCCEEEEecCCCCHHHHHHH-HHcCCEecceEEEEecc
Confidence            11 1236789999999999999999999999999999999999999999999999999998 99999999887666554
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} Back     alignment and structure
>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4 Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A* Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 399
d1sqha_297 d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr 1e-07
d1vkca_149 d.108.1.1 (A:) Putative acetyltransferase PF0028 { 1e-06
d2hv2a2285 d.108.1.10 (A:2-286) Hypothetical protein EF1021 { 4e-04
d1u6ma_189 d.108.1.1 (A:) Putative acetyltransferase EF0945 { 5e-04
d1n71a_180 d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera 5e-04
d2gana1182 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P 5e-04
d1p0ha_308 d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter 7e-04
d1p0ha_308 d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter 8e-04
d2i00a2291 d.108.1.10 (A:10-300) Putative acetyltransferase E 0.001
d1s3za_147 d.108.1.1 (A:) Aminoglycoside N-acetyltransferase 0.001
d2aj6a1118 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {S 0.003
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: Hypothetical protein cg14615-pa
domain: Hypothetical protein cg14615-pa
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score = 50.4 bits (120), Expect = 1e-07
 Identities = 15/95 (15%), Positives = 26/95 (27%), Gaps = 13/95 (13%)

Query: 49  RFYAVHVMLVAELRENGELVGVVRGCIKGVGTKFEGQIVKLGCILGLRVSPRHRRMGIGF 108
                +  L     + GEL+       +               +  L+V P+  R G+G 
Sbjct: 198 ALVRFNKSLGICRSDTGELIAW---IFQN----------DFSGLGMLQVLPKAERRGLGG 244

Query: 109 HLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTS 143
            L  ++   + R             N  S  L   
Sbjct: 245 LLAAAMSREIARGEEITLTAWIVATNWRSEALLKR 279
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149 Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Length = 285 Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Length = 189 Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180 Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182 Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308 Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Length = 291 Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Length = 147 Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.8
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.78
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 99.76
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.76
d1tiqa_173 Protease synthase and sporulation negative regulat 99.75
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 99.73
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 99.72
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 99.72
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.72
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.71
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 99.71
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.7
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 99.7
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.69
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 99.69
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 99.69
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 99.69
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 99.68
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 99.68
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 99.68
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 99.67
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.67
d2hv2a2285 Hypothetical protein EF1021 {Enterococcus faecalis 99.67
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 99.65
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.65
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.65
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 99.64
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 99.64
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.63
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 99.63
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 99.62
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 99.61
d2i00a2291 Putative acetyltransferase EF2353 {Enterococcus fa 99.6
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.59
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.58
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 99.57
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.56
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 99.52
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 99.51
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 99.48
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 99.48
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.47
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 99.46
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.46
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 99.45
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 99.43
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 99.42
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 99.42
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 99.4
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 99.39
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 99.37
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 99.37
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 99.34
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 99.27
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.26
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 99.25
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 98.7
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 98.08
d1ylea1338 Arginine N-succinyltransferase, alpha chain, AstA 97.66
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 97.13
d1lrza3182 Methicillin resistance protein FemA {Staphylococcu 97.09
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 96.86
d1iica1185 N-myristoyl transferase, NMT {Baker's yeast (Sacch 96.64
d1iyka1165 N-myristoyl transferase, NMT {Yeast (Candida albic 96.58
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [T 95.91
d1rxta1141 N-myristoyl transferase, NMT {Human (Homo sapiens) 95.46
d2d4pa1130 Hypothetical protein TTHA1254 {Thermus thermophilu 95.27
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 94.24
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 92.67
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 86.54
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 85.93
d1lrza2165 Methicillin resistance protein FemA {Staphylococcu 85.07
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 84.98
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 84.35
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 81.52
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Aminoglycoside N-acetyltransferase AAC(6')-IY
species: Salmonella enteritidis [TaxId: 149539]

Probab=99.80  E-value=1.6e-18  Score=146.87  Aligned_cols=141  Identities=17%  Similarity=0.197  Sum_probs=112.6

Q ss_pred             ceEEEEcCCcchHHHHHHHHHHhccCCCchh--HHHHHHhcChhhhhhccCceEEEEEEECCCCCEEEEEEEEEeccCcc
Q 044426            4 RVLIREFNEARDVEVVGKLEKKCEIGSKNGV--ALFTNMTTDPLCRIRFYAVHVMLVAELRENGELVGVVRGCIKGVGTK   81 (399)
Q Consensus         4 ~~~IR~~~~~~Dl~~v~~L~~~~e~~~~~~~--~~~~~~l~dpl~ri~~~p~~~~lVAe~~~~geiVG~i~~~i~~~~~~   81 (399)
                      .|.||+++ .+|++++.+|............  ..+...+.        .+....+++..+  +++||++.+.+......
T Consensus         2 ~m~Ir~~~-~~d~~~~~~l~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~va~~~--~~~vG~~~~~~~~~~~~   70 (147)
T d1s3za_           2 HMDIRQMN-KTHLEHWRGLRKQLWPGHPDDAHLADGEEILQ--------ADHLASFIAMAD--GVAIGFADASIRHDYVN   70 (147)
T ss_dssp             CEEEEECC-GGGHHHHHHHHHHHSTTSCHHHHHHHHHHHHH--------CSSEEEEEEEET--TEEEEEEEEEEECSCCT
T ss_pred             ceEEEECC-HHHHHHHHHHHHHHCCCCCcHHHHHHHHHHhh--------CCCcEEEEEEEC--CEEEEEEEEEeecCccc
Confidence            58999999 9999999999988754332111  11222222        344677888888  89999998887654322


Q ss_pred             ccccccceEEEEEEEEccCcccchHHHHHHHHHHHHHHHCCCcEEEEEEecCCHHHHHHHHHhCCCEEEeeeeEEe
Q 044426           82 FEGQIVKLGCILGLRVSPRHRRMGIGFHLVKSVEEWLMRNGAHYTFLATEKNNVASTNLFTSRCNYMNFSSLFIFV  157 (399)
Q Consensus        82 ~~~~~~~~ayI~~l~V~P~~RgrGIG~~Ll~~~~e~~~~~G~~~i~l~v~~~N~aa~~lyy~k~GF~~~~t~~~~~  157 (399)
                      . ......+++..++|+|+|||+|||++|++.+++++++.|++.+.+.|..+|.+|++|| +|+||+.......|.
T Consensus        71 ~-~~~~~~~~i~~l~V~~~~rg~Gig~~Ll~~~~~~a~~~g~~~i~l~~~~~N~~a~~fY-~k~GF~~~~~~~~~~  144 (147)
T d1s3za_          71 G-CDSSPVVFLEGIFVLPSFRQRGVAKQLIAAVQRWGTNKGCREMASDTSPENTISQKVH-QALGFEETERVIFYR  144 (147)
T ss_dssp             T-CSSSSEEEEEEEEECGGGCSSSHHHHHHHHHHHHHHHTTCSEEEEEECTTCHHHHHHH-HHTTCEEEEEEEEEE
T ss_pred             c-cCCCCeEEEEEEEECHHHcCCcHHHHHHHHHHHHhhhccccceEEEEcCCCHHHHHHH-HHCCCEEECeEEEEE
Confidence            1 2345789999999999999999999999999999999999999999999999999997 999999888765553
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lrza2 d.108.1.4 (A:1-165) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure