Citrus Sinensis ID: 044563
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 290 | ||||||
| 224109384 | 285 | predicted protein [Populus trichocarpa] | 0.917 | 0.933 | 0.601 | 2e-86 | |
| 225449218 | 308 | PREDICTED: uncharacterized protein At2g3 | 0.979 | 0.922 | 0.578 | 9e-86 | |
| 449521679 | 306 | PREDICTED: uncharacterized protein At2g3 | 0.937 | 0.888 | 0.491 | 2e-77 | |
| 449465029 | 306 | PREDICTED: uncharacterized protein At2g3 | 0.937 | 0.888 | 0.485 | 5e-77 | |
| 356537972 | 298 | PREDICTED: uncharacterized protein At2g3 | 0.958 | 0.932 | 0.481 | 1e-72 | |
| 357461141 | 307 | hypothetical protein MTR_3g070090 [Medic | 0.979 | 0.925 | 0.471 | 2e-69 | |
| 356569321 | 304 | PREDICTED: uncharacterized protein At2g3 | 0.975 | 0.930 | 0.460 | 3e-67 | |
| 356551538 | 299 | PREDICTED: uncharacterized protein At2g3 | 0.955 | 0.926 | 0.408 | 1e-61 | |
| 357492537 | 297 | hypothetical protein MTR_5g081740 [Medic | 0.944 | 0.922 | 0.432 | 2e-57 | |
| 217074214 | 297 | unknown [Medicago truncatula] | 0.944 | 0.922 | 0.432 | 4e-57 |
| >gi|224109384|ref|XP_002315179.1| predicted protein [Populus trichocarpa] gi|222864219|gb|EEF01350.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 324 bits (831), Expect = 2e-86, Method: Compositional matrix adjust.
Identities = 160/266 (60%), Positives = 206/266 (77%)
Query: 22 GSVIFIGGLITVGVLLITLLVTLAVMLQSCQNRSSGVVELTKSSGDNNYCKLFALHAELN 81
+ IFI L+TVGVLL TLLV+LAVMLQSCQ+RS GV+E+ K S D NYCK+FALHAELN
Sbjct: 17 AATIFIASLVTVGVLLTTLLVSLAVMLQSCQDRSKGVIEIQKLSHDYNYCKMFALHAELN 76
Query: 82 SLEADNLPEICRGLAIRYIKEGQFARDLNLSIQIVESYFNTLTPSYNGLDVVLMDIDDIF 141
SL D+ P +C LA+++ K G + RDLN S+ ++E YF++L P ++GLDV+LMDIDDIF
Sbjct: 77 SLGPDDFPSMCASLAVQHNKGGAYERDLNASLLMIERYFDSLLPLHDGLDVLLMDIDDIF 136
Query: 142 ASSSKYSNLLIDRVNVRGYIECIEEAKHLKHMFTLKLFMKLQVRGWPVILLSRKHEGQRN 201
S+ +Y++LL++RV G I+C +E KHLK + L L+ KLQ GW +ILLSRK E RN
Sbjct: 137 PSNIRYTSLLMNRVRDNGCIDCFQEEKHLKQILCLSLYTKLQASGWSLILLSRKPEKLRN 196
Query: 202 ATTELLISAGYRGWSSLIMRLDNEMQMDSREYLSRRRTILQKEGFHITGLISNQMDALIG 261
AT + LISAGYRGWSS IMR DNE+++DSREY SRR +QK GF I+G+IS+QMDAL
Sbjct: 197 ATIQHLISAGYRGWSSTIMRSDNEIEIDSREYFSRRMVAMQKAGFRISGVISSQMDALTS 256
Query: 262 QSLGKRVFKLPNPLYYSFDHHIESTK 287
SLG RVFKLPNP+YY+F+HH +++
Sbjct: 257 ASLGHRVFKLPNPVYYNFEHHTGNSR 282
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225449218|ref|XP_002279793.1| PREDICTED: uncharacterized protein At2g39920 [Vitis vinifera] gi|296086101|emb|CBI31542.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449521679|ref|XP_004167857.1| PREDICTED: uncharacterized protein At2g39920-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449465029|ref|XP_004150231.1| PREDICTED: uncharacterized protein At2g39920-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356537972|ref|XP_003537480.1| PREDICTED: uncharacterized protein At2g39920-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357461141|ref|XP_003600852.1| hypothetical protein MTR_3g070090 [Medicago truncatula] gi|355489900|gb|AES71103.1| hypothetical protein MTR_3g070090 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356569321|ref|XP_003552851.1| PREDICTED: uncharacterized protein At2g39920-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356551538|ref|XP_003544131.1| PREDICTED: uncharacterized protein At2g39920-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357492537|ref|XP_003616557.1| hypothetical protein MTR_5g081740 [Medicago truncatula] gi|355517892|gb|AES99515.1| hypothetical protein MTR_5g081740 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217074214|gb|ACJ85467.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 290 | ||||||
| TAIR|locus:2061201 | 283 | AT2G39920 [Arabidopsis thalian | 0.724 | 0.742 | 0.412 | 7.4e-40 | |
| TAIR|locus:2118329 | 256 | AT4G29270 [Arabidopsis thalian | 0.772 | 0.875 | 0.305 | 1.4e-25 | |
| TAIR|locus:2118314 | 255 | AT4G29260 [Arabidopsis thalian | 0.751 | 0.854 | 0.300 | 1e-22 | |
| TAIR|locus:2172447 | 272 | AT5G44020 [Arabidopsis thalian | 0.755 | 0.805 | 0.293 | 1e-22 | |
| TAIR|locus:2024102 | 271 | AT1G04040 [Arabidopsis thalian | 0.758 | 0.811 | 0.284 | 2.6e-22 | |
| TAIR|locus:2064128 | 251 | AT2G38600 [Arabidopsis thalian | 0.720 | 0.832 | 0.303 | 3e-21 | |
| TAIR|locus:2176267 | 257 | AT5G51260 [Arabidopsis thalian | 0.724 | 0.817 | 0.280 | 8.3e-19 | |
| TAIR|locus:2117338 | 260 | AT4G25150 [Arabidopsis thalian | 0.741 | 0.826 | 0.280 | 2.2e-18 | |
| TAIR|locus:2184585 | 270 | VSP1 "AT5G24780" [Arabidopsis | 0.744 | 0.8 | 0.290 | 4e-12 | |
| TAIR|locus:2184580 | 265 | VSP2 "AT5G24770" [Arabidopsis | 0.741 | 0.811 | 0.28 | 7.1e-11 |
| TAIR|locus:2061201 AT2G39920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 404 (147.3 bits), Expect = 7.4e-40, Sum P(2) = 7.4e-40
Identities = 97/235 (41%), Positives = 144/235 (61%)
Query: 45 AVMLQSCQNRSSGVVELTKSSGDNNYCKLFALHAELNSLEADN-LPEICRGLAIRYIKEG 103
+ MLQSC+NR+ +VE + YCK+ +LH++LNSL+ ++ LP +CR +A+ IK+G
Sbjct: 62 STMLQSCENRNIAIVEAQRLDESFGYCKILSLHSQLNSLDEESELPLLCRDVALHRIKQG 121
Query: 104 QFARDLNLSIQIVESYFNTLTPSYNGLDVVLMDIDDIFASSSKYSNLLIDRVNVRGYIEC 163
+ R+LN +IQ+ +YF T+ P + DVV++DIDD +NLL ++ + Y++
Sbjct: 122 IYLRELNFTIQMALTYFQTIKPMNDNCDVVVIDIDD--------TNLL-EQDSY--YMKY 170
Query: 164 IEEAKHLKHMFTLKLFMKLQVRGWPVILLSRKHEGQRNATTELLISAGYRGWSSLIMRLD 223
IEEAKH K + L L+ KL+ +G+ ++LLSR+ E +RNAT E L S GY WS LIM +
Sbjct: 171 IEEAKHQKSILILALYSKLRSQGYSMVLLSRRPETERNATIEQLKSRGYSDWSHLIMSRE 230
Query: 224 NEMQMDSREYLSRRRTILQKEGFHITGLISNQMDALIGQS--LGKRVFKLPNPLY 276
+ Q +E L R G + G+I N MD L GQ KR+FKLP+ Y
Sbjct: 231 DTRQ---KEELER--------GHRVIGVIGNHMDVLRGQWNWQSKRLFKLPSLTY 274
|
|
| TAIR|locus:2118329 AT4G29270 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118314 AT4G29260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2172447 AT5G44020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024102 AT1G04040 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2064128 AT2G38600 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2176267 AT5G51260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117338 AT4G25150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184585 VSP1 "AT5G24780" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184580 VSP2 "AT5G24770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 290 | |||
| TIGR01675 | 229 | TIGR01675, plant-AP, plant acid phosphatase | 6e-39 | |
| pfam03767 | 213 | pfam03767, Acid_phosphat_B, HAD superfamily, subfa | 1e-27 | |
| TIGR01680 | 275 | TIGR01680, Veg_Stor_Prot, vegetative storage prote | 4e-13 |
| >gnl|CDD|130736 TIGR01675, plant-AP, plant acid phosphatase | Back alignment and domain information |
|---|
Score = 136 bits (343), Expect = 6e-39
Identities = 71/229 (31%), Positives = 109/229 (47%), Gaps = 8/229 (3%)
Query: 55 SSGVVELTKSSGDNNYCKLFALHAELNSLEA-DNLPEICRGLAIRYIKEGQFARDLNLSI 113
++ K S D YC+ + L E N++ D +P C+ Y+ Q+ RD+ +
Sbjct: 1 VLEILMKEKLSIDYAYCRSWRLGVETNNIRDWDTVPAECKDYVEDYMTSKQYKRDVKRVV 60
Query: 114 QIVESYFNTLTPSYNGLDVVLMDIDDIFASSSKYSNLL---IDRVNVRGYIECIE--EAK 168
Y +L S +G+D + D+DD S+ Y ++ + + + A
Sbjct: 61 DEAYFYAKSLALSGDGMDAWIFDVDDTLLSNIPYYKKHGYGTEKTDPTAFWLWLGKGAAP 120
Query: 169 HLKHMFTLKLFMKLQVRGWPVILLSRKHEGQRNATTELLISAGYRGWSSLIMRLDNEMQM 228
L LKL+ K+ G + LLS + E RNAT + LI+AG+ GW LI+R +
Sbjct: 121 ALPEG--LKLYQKIIELGIKIFLLSGRWEELRNATLDNLINAGFTGWKHLILRGLEDSNK 178
Query: 229 DSREYLSRRRTILQKEGFHITGLISNQMDALIGQSLGKRVFKLPNPLYY 277
Y S R L +EG+ I G I +Q L+G G+R FKLPNP+YY
Sbjct: 179 TVVTYKSEVRKSLMEEGYRIWGNIGDQWSDLLGSPPGRRTFKLPNPMYY 227
|
This model represents a family of acid phosphatase from plants which are most closely related to the (so called) class B non-specific acid phosphatase OlpA (TIGR01533, which is believed to be a 5'-nucleotide phosphatase) and somewhat more distantly to another class B phosphatase, AphA (TIGR01672). Together these three clades define a subfamily (pfam03767) which corresponds to the IIIB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate nucleophile hydrolases. It has been reported that the best substrate for this enzyme that could be found was purine 5'-nucleoside phosphates. This is in concordance with the assignment of the H. influenzae hel protein (from TIGR01533) as a 5'-nucleotidase, however there is presently no other evidence to support this specific function for these plant phosphatases. Many genes from this family have been annotated as vegetative storage proteins due to their close homology with these earlier-characterized gene products which are highly expressed in leaves. There are significant differences however, including expression levels and distribution. The most important difference is the lack in authentic VSPs of the nucleophilic aspartate residue, which is instead replaced by serine, glycine or asparagine. Thus these proteins can not be expected to be active phosphatases. This issue was confused by the publication in 1992 of an article claiming activity for the Glycine max VSP. In 1994 this assertion was refuted by the separation of the activity from the VSP. This model explicitly excludes the VSPs which lack the nucleophilc aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases. Length = 229 |
| >gnl|CDD|217719 pfam03767, Acid_phosphat_B, HAD superfamily, subfamily IIIB (Acid phosphatase) | Back alignment and domain information |
|---|
| >gnl|CDD|130741 TIGR01680, Veg_Stor_Prot, vegetative storage protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 100.0 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 100.0 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 100.0 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 100.0 | |
| COG2503 | 274 | Predicted secreted acid phosphatase [General funct | 100.0 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 99.79 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 99.55 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 99.14 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 99.09 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.02 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 98.98 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 98.71 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 98.33 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 98.28 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 98.28 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 98.06 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 98.04 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 98.0 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 97.98 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 97.9 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 97.88 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 97.88 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 97.84 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 97.84 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 97.82 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 97.82 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 97.79 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 97.78 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 97.75 | |
| PLN02954 | 224 | phosphoserine phosphatase | 97.74 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 97.73 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 97.73 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 97.68 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 97.67 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 97.62 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 97.62 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 97.61 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 97.61 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 97.58 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 97.58 | |
| PRK06769 | 173 | hypothetical protein; Validated | 97.57 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 97.57 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 97.56 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 97.56 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 97.54 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 97.53 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 97.5 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 97.49 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 97.49 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 97.46 | |
| COG0647 | 269 | NagD Predicted sugar phosphatases of the HAD super | 97.45 | |
| PLN02940 | 382 | riboflavin kinase | 97.43 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 97.3 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 97.29 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 97.27 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 97.25 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 97.21 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 97.2 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 97.15 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 97.13 | |
| COG5083 | 580 | SMP2 Uncharacterized protein involved in plasmid m | 97.13 | |
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 97.06 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 97.06 | |
| PF11019 | 252 | DUF2608: Protein of unknown function (DUF2608); In | 97.06 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.05 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 97.03 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 97.02 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 96.99 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 96.98 | |
| COG4850 | 373 | Uncharacterized conserved protein [Function unknow | 96.97 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 96.96 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 96.96 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 96.96 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 96.94 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 96.89 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 96.88 | |
| TIGR01456 | 321 | CECR5 HAD-superfamily class IIA hydrolase, TIGR014 | 96.86 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 96.86 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 96.84 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 96.83 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 96.81 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 96.79 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 96.77 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 96.76 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 96.76 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 96.73 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 96.72 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 96.72 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 96.68 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 96.67 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 96.64 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 96.56 | |
| KOG3040 | 262 | consensus Predicted sugar phosphatase (HAD superfa | 96.56 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 96.55 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 96.52 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 96.52 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 96.48 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 96.29 | |
| PRK08238 | 479 | hypothetical protein; Validated | 96.29 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 96.28 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 96.27 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 96.26 | |
| PLN02887 | 580 | hydrolase family protein | 96.13 | |
| PLN03017 | 366 | trehalose-phosphatase | 96.13 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 96.12 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 96.09 | |
| KOG2116 | 738 | consensus Protein involved in plasmid maintenance/ | 96.03 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 95.98 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 95.97 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 95.92 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 95.88 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 95.86 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 95.75 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 95.75 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 95.55 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 95.5 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 95.47 | |
| PLN02423 | 245 | phosphomannomutase | 95.47 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 95.44 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 95.37 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 95.37 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 95.33 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 95.31 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 95.3 | |
| KOG2882 | 306 | consensus p-Nitrophenyl phosphatase [Inorganic ion | 95.27 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 95.26 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 95.18 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 95.16 | |
| PLN02151 | 354 | trehalose-phosphatase | 95.08 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 94.97 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 94.96 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 94.89 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 94.79 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 94.78 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 94.58 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 94.54 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 94.52 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 94.37 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 94.16 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 93.95 | |
| PLN02580 | 384 | trehalose-phosphatase | 93.93 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 93.93 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 93.88 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 93.86 | |
| PLN02811 | 220 | hydrolase | 93.71 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 93.49 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 93.4 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 93.37 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 93.17 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 93.15 | |
| KOG2914 | 222 | consensus Predicted haloacid-halidohydrolase and r | 93.09 | |
| PF10307 | 197 | DUF2410: Hypothetical protein (DUF2410); InterPro: | 92.98 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 92.6 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 92.39 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 92.37 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 92.2 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 91.93 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 91.45 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 91.35 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 91.25 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 91.17 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 91.16 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 91.13 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 90.85 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 90.49 | |
| KOG1615 | 227 | consensus Phosphoserine phosphatase [Amino acid tr | 90.29 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 90.29 | |
| KOG3120 | 256 | consensus Predicted haloacid dehalogenase-like hyd | 90.13 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 89.18 | |
| KOG1618 | 389 | consensus Predicted phosphatase [General function | 89.06 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 88.78 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 88.69 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 88.66 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 88.25 | |
| COG5663 | 194 | Uncharacterized conserved protein [Function unknow | 88.22 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 88.12 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 87.85 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 87.75 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 87.37 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 86.99 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 86.21 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 85.74 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 85.12 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 83.38 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 82.18 |
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
Probab=100.00 E-value=5e-79 Score=553.84 Aligned_cols=222 Identities=30% Similarity=0.494 Sum_probs=212.7
Q ss_pred CceeeccCCCCCCcccceehhhhcCCCCCCC-CchhhhHHHHhhhhhhhhHHHHHHHHHHHHHHHhhhCCCCCCCcEEEE
Q 044563 57 GVVELTKSSGDNNYCKLFALHAELNSLEADN-LPEICRGLAIRYIKEGQFARDLNLSIQIVESYFNTLTPSYNGLDVVLM 135 (290)
Q Consensus 57 ~~~~~~~~~~~~~~C~swrl~vE~nN~~~w~-vP~~C~~~v~~Y~~sgqY~~D~~~v~~~A~~y~~~~~~~~~g~~AvVf 135 (290)
.+++.+..+..++||+||||+||+||+++|+ ||++|++||++||+||||++|++.|+++|..|++++++++||++||||
T Consensus 3 ~~~~~~~~~~~~~~c~swr~~ve~~n~~~~~~vp~~c~~~v~~Y~~~~~Y~~D~~~v~~~a~~y~~~~~~~~dg~~A~V~ 82 (229)
T TIGR01675 3 EILMKEKLSIDYAYCRSWRLGVETNNIRDWDTVPAECKDYVEDYMTSKQYKRDVKRVVDEAYFYAKSLALSGDGMDAWIF 82 (229)
T ss_pred ceeehhcccCCcCcchhhhhhhhhccccccccCcHHHHHHHHHhhcccccHHHHHHHHHHHHHHHHHhhccCCCCcEEEE
Confidence 3555666667789999999999999999997 999999999999999999999999999999999999999999999999
Q ss_pred eccc-ccccChhhhhhccCC--CCccchHHHHHhhcCcCcHHHHHHHHHHHhCCCeEEEecCCCccchHHHHHHHHhCCC
Q 044563 136 DIDD-IFASSSKYSNLLIDR--VNVRGYIECIEEAKHLKHMFTLKLFMKLQVRGWPVILLSRKHEGQRNATTELLISAGY 212 (290)
Q Consensus 136 DIDe-tLsn~~y~~~~~~G~--~~~~~w~~Wv~~~~apaip~~l~l~~~l~~~Gv~V~~iSgR~e~~r~~T~~NL~~~Gy 212 (290)
|||| +|+|.|||+.|.+|. |++++|++|+..+++||+|++++|+++|+++|++|||+|||++.+|++|++||+++||
T Consensus 83 DIDET~LsN~py~~~~~~g~~~~~~~~~~~wv~~~~apaip~al~l~~~l~~~G~~Vf~lTGR~e~~r~~T~~nL~~~G~ 162 (229)
T TIGR01675 83 DVDDTLLSNIPYYKKHGYGTEKTDPTAFWLWLGKGAAPALPEGLKLYQKIIELGIKIFLLSGRWEELRNATLDNLINAGF 162 (229)
T ss_pred ccccccccCHHHHHHhccCCCcCCHHHHHHHHHcCCCCCCHHHHHHHHHHHHCCCEEEEEcCCChHHHHHHHHHHHHcCC
Confidence 9999 999999999998874 9999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCcceeecCcccCcchHHhhHHHHHHHHhcCCeEEEEeCCCcccccCCCCcceEEEccCCcccc
Q 044563 213 RGWSSLIMRLDNEMQMDSREYLSRRRTILQKEGFHITGLISNQMDALIGQSLGKRVFKLPNPLYYS 278 (290)
Q Consensus 213 ~~~d~LiLR~~~~~~~~~~~yKs~~R~~i~~~GYrIv~~iGDq~sDl~G~~~g~r~fkLPNPmY~~ 278 (290)
++|++|+||+.++.++++++||+++|++|+++||||+++||||||||.|++.|+|+|||||||||+
T Consensus 163 ~~~~~LiLR~~~d~~~~~~~yKs~~R~~l~~~GYrIv~~iGDq~sDl~G~~~~~RtFKLPNPmYyi 228 (229)
T TIGR01675 163 TGWKHLILRGLEDSNKTVVTYKSEVRKSLMEEGYRIWGNIGDQWSDLLGSPPGRRTFKLPNPMYYV 228 (229)
T ss_pred CCcCeeeecCCCCCCchHhHHHHHHHHHHHhCCceEEEEECCChHHhcCCCccCceeeCCCCcccC
Confidence 999999999988888899999999999999999999999999999999999999999999999996
|
This model explicitly excludes the VSPs which lack the nucleophilc aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases. |
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >COG2503 Predicted secreted acid phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] | Back alignment and domain information |
|---|
| >PF10307 DUF2410: Hypothetical protein (DUF2410); InterPro: IPR018812 This entry represents a family of proteins conserved in fungi whose function is not known | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG1618 consensus Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >COG5663 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 290 | |||
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 4e-18 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 4e-17 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 2e-16 |
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Length = 258 | Back alignment and structure |
|---|
Score = 80.8 bits (198), Expect = 4e-18
Identities = 24/190 (12%), Positives = 61/190 (32%), Gaps = 24/190 (12%)
Query: 119 YFNTLTPSYNGLDVVLMDIDDIFASSSKYSNLLI--DRVNVRGYIECIEEAKHLKHMFTL 176
L +++D+D+ +S + + + + + + I +A+ ++
Sbjct: 48 LDAALAKGTEKKPAIVLDLDETVLDNSPHQAMSVKTGKGYPYKWDDWINKAEAEALPGSI 107
Query: 177 KLFMKLQVRGWPVILLSRKHEGQRNATTELLISAGYRGWSSLIMRLDNEMQMDSREYLSR 236
+ +G + +S + Q +AT + L G + + L + +
Sbjct: 108 DFLKYTESKGVDIYYISNRKTNQLDATIKNLERVGAPQATKEHILLQDPKEKGKE----- 162
Query: 237 RRTILQKEGFHITGLISNQMDALIGQSL-----------------GKRVFKLPNPLYYSF 279
+R L + I + + G G++ PNP+Y +
Sbjct: 163 KRRELVSQTHDIVLFFGDNLSDFTGFDGKSVKDRNQAVTDSKAQFGEKFIIFPNPMYGDW 222
Query: 280 DHHIESTKFP 289
+ + F
Sbjct: 223 EGALYDYNFK 232
|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Length = 262 | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Length = 260 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 100.0 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 100.0 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 99.98 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 98.93 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 98.74 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.56 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 98.47 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 98.4 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 98.39 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 98.37 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 98.29 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.22 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 98.15 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 98.15 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 98.14 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.14 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 98.13 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.13 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.13 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 98.12 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 98.11 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 98.11 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 98.11 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.1 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 98.09 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 98.08 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 98.06 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 98.05 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 98.04 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 98.03 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 97.99 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 97.97 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.96 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 97.96 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 97.92 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 97.91 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 97.91 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 97.9 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 97.89 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 97.89 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 97.88 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 97.88 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 97.85 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 97.85 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 97.85 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 97.84 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 97.82 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 97.82 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 97.81 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 97.81 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 97.81 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 97.8 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 97.79 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 97.79 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 97.78 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 97.77 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 97.76 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 97.75 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 97.75 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 97.73 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 97.72 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 97.7 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 97.7 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 97.68 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 97.68 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 97.67 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.65 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 97.63 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 97.62 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 97.61 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 97.61 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 97.6 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 97.59 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 97.54 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 97.53 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 97.53 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 97.53 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.51 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 97.5 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 97.5 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 97.5 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 97.47 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 97.44 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 97.42 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 97.42 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 97.41 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.41 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 97.4 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 97.38 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 97.34 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 97.34 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 97.3 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 97.3 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 97.27 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 97.24 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 97.22 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 97.17 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 97.13 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 97.12 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 97.11 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 97.04 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 97.02 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 97.02 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 97.01 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 97.01 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 97.0 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 96.95 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 96.95 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 96.95 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 96.93 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 96.92 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 96.91 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 96.89 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 96.86 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 96.79 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 96.78 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 96.77 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 96.76 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 96.7 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 96.65 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 96.54 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 96.53 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 96.53 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 96.4 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 96.38 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 96.37 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 96.16 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 96.05 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 95.94 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 95.6 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 95.45 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 95.45 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 95.44 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 95.43 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 95.26 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 94.97 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 94.94 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 94.63 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 94.41 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 92.96 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 93.86 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 93.82 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 93.82 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 93.77 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 93.76 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 93.65 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 93.34 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 93.2 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 93.17 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 93.1 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 92.9 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 92.54 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 92.36 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 92.31 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 90.17 | |
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 89.06 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 88.74 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 83.81 |
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-47 Score=349.40 Aligned_cols=188 Identities=11% Similarity=0.193 Sum_probs=172.2
Q ss_pred hhhHHHHhhhhhhhhHHHHHHHHHHHHHHHhhhCCCCCCCcEEEEeccc-ccccChhhhhhccC--CCCccchHHHHHhh
Q 044563 91 ICRGLAIRYIKEGQFARDLNLSIQIVESYFNTLTPSYNGLDVVLMDIDD-IFASSSKYSNLLID--RVNVRGYIECIEEA 167 (290)
Q Consensus 91 ~C~~~v~~Y~~sgqY~~D~~~v~~~A~~y~~~~~~~~~g~~AvVfDIDe-tLsn~~y~~~~~~G--~~~~~~w~~Wv~~~ 167 (290)
+-+-.+.||++|++|++++.++++.|+.|+++....+++|+|||||||| +|+|.+||..+..+ .|+++.|++|+..+
T Consensus 19 ~~~~a~~w~q~S~Ey~al~~q~yn~A~~~ld~~~~~~~~~~avVfDIDgTlldn~~y~~~~~~~~~~f~~~~w~~wv~~~ 98 (262)
T 3ocu_A 19 QAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLNETMLDNSPYAGWQVQNNKPFDGKDWTRWVDAR 98 (262)
T ss_dssp TTHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHCCCCTTCEEEEEECCBTTTEECHHHHHHHHHHTCCCCHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCeEEEEECCCcCCCCchhhhhhccccccCCHHHHHHHHHcC
Confidence 4456799999999999999999999999999987777889999999999 77777888776533 49999999999999
Q ss_pred cCcCcHHHHHHHHHHHhCCCeEEEecCCCcc-chHHHHHHHHhCCCCCCC--cceeecCcccCcchHHhhHHHHHHHHhc
Q 044563 168 KHLKHMFTLKLFMKLQVRGWPVILLSRKHEG-QRNATTELLISAGYRGWS--SLIMRLDNEMQMDSREYLSRRRTILQKE 244 (290)
Q Consensus 168 ~apaip~~l~l~~~l~~~Gv~V~~iSgR~e~-~r~~T~~NL~~~Gy~~~d--~LiLR~~~~~~~~~~~yKs~~R~~i~~~ 244 (290)
.++++||+++|++.|+++|++|+|||||++. +|+.|++||+++|++.|+ +|+||+.. .+|+.+|++|+++
T Consensus 99 ~~~~~pG~~ell~~L~~~G~ki~ivTgR~~~~~r~~T~~~L~~lGi~~~~~~~Lilr~~~-------~~K~~~r~~l~~~ 171 (262)
T 3ocu_A 99 QSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDK-------SAKAARFAEIEKQ 171 (262)
T ss_dssp CCEECTTHHHHHHHHHHTTEEEEEEEEEETTTTHHHHHHHHHHHTCSCCSGGGEEEESSC-------SCCHHHHHHHHHT
T ss_pred CCCCCccHHHHHHHHHHCCCeEEEEeCCCccchHHHHHHHHHHcCcCcccccceeccCCC-------CChHHHHHHHHhc
Confidence 9999999999999999999999999999998 999999999999999988 99999653 3799999999999
Q ss_pred CCeEEEEeCCCcccccCCC------------------CcceEEEccCCccccccccccc
Q 044563 245 GFHITGLISNQMDALIGQS------------------LGKRVFKLPNPLYYSFDHHIES 285 (290)
Q Consensus 245 GYrIv~~iGDq~sDl~G~~------------------~g~r~fkLPNPmY~~we~~~~~ 285 (290)
||+|+++|||||+||.|.+ +|.++|+|||||||+||+.+-.
T Consensus 172 Gy~iv~~vGD~~~Dl~~~~~~~~~~~r~a~v~~~~~~fG~~~ivlPNp~YG~we~~~~~ 230 (262)
T 3ocu_A 172 GYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAE 230 (262)
T ss_dssp TEEEEEEEESSGGGGCSTTTTCCHHHHHHHHHHTGGGBTTTEEECCCSSCSHHHHTTST
T ss_pred CCCEEEEECCChHHhccccccCCHHHHHHHHHHHHHHhCCCEEEeCCCCccchhHHhcC
Confidence 9999999999999999965 7999999999999999998743
|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 290 | |||
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 99.96 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 99.76 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 99.11 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 99.0 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 98.57 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 98.35 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 98.34 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 98.29 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 98.11 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 98.02 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 98.0 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 97.91 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 97.9 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 97.88 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 97.84 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 97.82 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 97.75 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 97.74 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 97.71 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 97.61 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 97.55 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 97.42 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 97.39 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 97.36 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.27 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.26 | |
| d1q92a_ | 195 | 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo | 97.25 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 97.21 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 97.21 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 97.14 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 97.13 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 96.98 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 96.96 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 96.83 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 96.79 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 96.76 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 96.68 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 96.67 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 96.53 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 96.52 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 96.26 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 96.22 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 96.12 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 95.95 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 95.88 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 95.72 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 95.58 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 95.49 | |
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 95.29 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 95.0 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 94.83 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 94.73 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 94.51 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 93.5 | |
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 87.47 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 83.92 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 83.1 |
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Class B acid phosphatase, AphA domain: Class B acid phosphatase, AphA species: Escherichia coli [TaxId: 562]
Probab=99.96 E-value=3.9e-31 Score=234.23 Aligned_cols=145 Identities=15% Similarity=0.159 Sum_probs=116.9
Q ss_pred CCCCcEEEEeccc-ccccChhhhhhc--c---CC---CCccchHHHHH--hhcCcCcHHHHHHHHHHHhCCCeEEEecCC
Q 044563 127 YNGLDVVLMDIDD-IFASSSKYSNLL--I---DR---VNVRGYIECIE--EAKHLKHMFTLKLFMKLQVRGWPVILLSRK 195 (290)
Q Consensus 127 ~~g~~AvVfDIDe-tLsn~~y~~~~~--~---G~---~~~~~w~~Wv~--~~~apaip~~l~l~~~l~~~Gv~V~~iSgR 195 (290)
+.+|.|||||||| +|+|+||+.... + |. ++++.|+.|+. ++.++|+||+++|+++++++|++|||||||
T Consensus 32 g~~P~AIifDIDETvLdnspy~~~~~~~~~~~~~~y~~~~~~W~~~~~~~~~~A~p~pga~~fl~~~~~~Gv~IfyVTnR 111 (209)
T d2b82a1 32 GRPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGR 111 (209)
T ss_dssp TCCCCEEEECCBTTTEECHHHHHHHHHHHCTTSSGGGGCHHHHHHHHTTGGGGCEECHHHHHHHHHHHHHTCEEEEEECS
T ss_pred CCCCceEEEcchhhhhcCcHHHHhhhhhcCcCcccccCCCcchHHHhcccccccCcchhHHHHHHHHHHcCCeEEEEeCC
Confidence 3445599999999 999999854321 1 11 57888988886 466889999999999999999999999999
Q ss_pred CccchHHHHHHHHh-CCCCC--CCcceeecCcccCcchHHhhHHHHHHHHhcCCeEEEEeCCCccccc-----CCCCcce
Q 044563 196 HEGQRNATTELLIS-AGYRG--WSSLIMRLDNEMQMDSREYLSRRRTILQKEGFHITGLISNQMDALI-----GQSLGKR 267 (290)
Q Consensus 196 ~e~~r~~T~~NL~~-~Gy~~--~d~LiLR~~~~~~~~~~~yKs~~R~~i~~~GYrIv~~iGDq~sDl~-----G~~~g~r 267 (290)
++.+++.|++||++ .||+. ..+++|++... +|..+|+.|+ + |+|++++||||+||. |.. +.|
T Consensus 112 ~~~~~e~T~~nL~K~lG~p~~~~~~vll~~~~~-------~K~~rr~~Ik-~-y~I~l~~GD~l~Df~aA~eagi~-~iR 181 (209)
T d2b82a1 112 SPTKTETVSKTLADNFHIPATNMNPVIFAGDKP-------GQNTKSQWLQ-D-KNIRIFYGDSDNDITAARDVGAR-GIR 181 (209)
T ss_dssp CCCSSCCHHHHHHHHTTCCTTTBCCCEECCCCT-------TCCCSHHHHH-H-TTEEEEEESSHHHHHHHHHTTCE-EEE
T ss_pred chhhHHHHHHHHHHHcCCCcccccceEeeCCCC-------CchHHHHHHH-H-cCeEEEecCCHHHHhHHHHcCCC-ceE
Confidence 99999999999976 89984 45788875442 6778888884 4 999999999999996 443 788
Q ss_pred EEEccCCccccccc
Q 044563 268 VFKLPNPLYYSFDH 281 (290)
Q Consensus 268 ~fkLPNPmY~~we~ 281 (290)
.+++||++|.+++.
T Consensus 182 i~r~~~s~y~p~p~ 195 (209)
T d2b82a1 182 ILRASNSTYKPLPQ 195 (209)
T ss_dssp CCCCTTCSSCSCCC
T ss_pred eeccCCCCCCCchh
Confidence 88888888876554
|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|