Citrus Sinensis ID: 044582

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--

MSPEKVNHLPESDTKLTLGLPGAGGECHRTKAGTKRGFLETVDLNLMSSSNDNKHCEENDAMASTTTPATKAQVVGWPPVRAYRKSAMKGSCKFVKVAVEGAPYLRKVDLEIYHSYQELLSALEDMFSFLTIRNHVNERKIIDNVNGVEYVPTYEDKDGDWMLVGDVPWKMFVESCKRVRLMKSSEAIGLAPRTPAKNSSKS

cccccccccccccHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccHHHHccccccccEEEEEEccccccEEEcccccccHHHHHHHHHHHHcccccccccccHHHcccccccCEEEEEEcccccEEEcccccHHHHHHHccccEEEcccHHccccccccccccccc

**********ESDTKLTLGL***************************************************AQVVGWPPVRAYRKSAMKGSCKFVKVAVEGAPYLRKVDLEIYHSYQELLSALEDMFSFLTIRNHVNERKIIDNVNGVEYVPTYEDKDGDWMLVGDVPWKMFVESCKRVRLM********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Auxin-responsive protein IAA14	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.	probable	Q38832
Auxin-responsive protein IAA15	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	probable	Q6AT10
Auxin-induced protein 22D	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.	probable	O24542

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KTR, chain A
Confidence level:probable
Coverage over the Query: 92-130,146-167
View the alignment between query and template
View the model in PyMOL