Citrus Sinensis ID: 044606


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410---
FPILSHRKEKPPELTTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIPQKIQEEEEEREHRPHHQQLSFEIETESASSPSSSTSPSEEDDEEKSLFYGLRENPKRSIRLVDPEFSFGVVDASAAAAAAASASVVLQDRESETESSKNPTRRRSKRTRKLEQQHRQELDIIKKLKLNKSKNTIESSLWGHEPEPVSSISDTTTEEDQQQHHHDLIMFRQQDDDEYEDEEAEKSMDETDESEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTGLVASTSARSASASTKLGENLIDLNLPAPIDDDDISQIELSAVSDAEFVNHIKR
ccccccccccccccccccccEEEccccccccccccccccccccccccccccccccHHHHHHccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHcccccEEcccccccccccHHHHHHccccccHHHHHHcccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccEEcccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHccccc
cccccccccccccHHHHHEEEEEEEEEEEcccccHHHHcccEEEEEcccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccHHccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEcccccccccHHHccccccccccccccccccccccccccccccccccccccccccEEEccccccEcccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccc
fpilshrkekppelttfKLLFIIYVYVFFKKRKSLFVMEKHKcrlcfknfsngralgghmrshmlnlpipqkiqeeeeerehrphhqqlsfeietesasspssstspseeddeekslfyglrenpkrsirlvdpefsfgvVDASAAAAAAASASVVLQdresetessknptrrrsKRTRKLEQQHRQELDIIKKLklnkskntiesslwghepepvssisdttteedqqQHHHDLIMfrqqdddeyedeeaeksmdetdeseefksfnnknrsrgkykceTCKKVFKSYqalgghrashkkikfytpvqeteldqenagasinlaspplsvkkvhecpvcfrvfssgqalgghkrthvTGLVAstsarsasastklgenlidlnlpapiddddisqielsavsdaefvnhikr
fpilshrkekppelttfkLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIPQKIQEEEEEREHRPHHQQLSfeietesasspssstspseeddeEKSLfyglrenpkrsIRLVDPEFSFGVVDASAAAAAAASASvvlqdresetessknptrrrskrtrkleqqhrqeldiikklklnkskntiesslwghepepVSSISDTTTEEDQQQHHHDLIMFRQQDDDEYEDEEAeksmdetdeseefksfnnknrsrgkykceTCKKVFKSyqalgghrashKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFssgqalgghkRTHVTGLVASTSARSASASTKLGENLIDLNLPAPIDDDDISQIElsavsdaefvnhikr
FPILSHRKEKPPELTTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIPQKIqeeeeerehrphhqqLSFeietesasspssstspseeddeeksLFYGLRENPKRSIRLVDPEFSFGVVDasaaaaaaasasVVLQDRESETESSKNPTRRRSKRTRKLEQQHRQELDiikklklnksknTIESSLWGHEPEPVSSISDTTTEEDQQQHHHDLIMFRQQdddeyedeeaeksmdeTDESEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTGLVastsarsasastKLGENLIDLNLPAPIDDDDISQIELSAVSDAEFVNHIKR
*************LTTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHM********************************************************************IRLVDPEFSFGVVDAS************************************************************************************************************************************YKCETCKKVFKSYQALGGHRASHKKIKFYTPV*******************PLSVKKVHECPVCFRVFSSGQALGGHKRTHVTGLV*****************LIDLNL****************************
FPILSHRKEKPPELTTFKLLFII*****************HKCRLCFKNFSNGRALGGHMRSHMLN*********************************************************************************************************************************************************************************************************************ETCKKVFKSY**********************************************ECPVCFRVFSSGQALGGHKRT************************IDLNLPAPIDDDDISQIELSAVSDAEFVNH***
FPILSHRKEKPPELTTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIPQKIQ*****************************************SLFYGLRENPKRSIRLVDPEFSFGVVDAS*****************************************RQELDIIKKLKLNKSKNTIESSLWGH********************HHDLIMFRQQD**************************NKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTGLVAS********STKLGENLIDLNLPAPIDDDDISQIELSAVSDAEFVNHIKR
F*ILSHRKEKPPELTTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRAL****************************************************************LRENPKRSIRLVDPEF****************************************************************************************EEDQQQHHHDLIMFRQQ********************************RGKYKCETCKKVFKSYQAL****************************************KVHECPVCFRVFSSGQAL****************************NLIDLNLPAPID*************DAEF******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FPILSHRKEKPPELTTFKLLFIIYVYVFFKKRKSLFVMEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIPQKIQEEEEEREHRPHHQQLSFEIETESASSPSSSTSPSEEDDEEKSLFYGLRENPKRSIRLVDPEFSFGVVDASAAAAAAASASVVLQDRESETESSKNPTRRRSKRTRKLEQQHRQELDIIKKLKLNKSKNTIESSLWGHEPEPVSSISDTTTEEDQQQHHHDLIMFRQQDDDEYEDEEAEKSMDETDESEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTGLVASTSARSASASTKLGENLIDLNLPAPIDDDDISQIELSAVSDAEFVNHIKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query413 2.2.26 [Sep-21-2011]
Q9M202288 Zinc finger protein ZAT9 yes no 0.665 0.954 0.396 9e-51
Q9SHD0314 Zinc finger protein ZAT4 no no 0.714 0.939 0.416 2e-43
Q39092267 Zinc finger protein ZAT1 no no 0.501 0.775 0.377 3e-27
Q681X4286 Zinc finger protein ZAT5 no no 0.302 0.437 0.35 3e-16
Q9SSW2273 Zinc finger protein AZF2 no no 0.193 0.293 0.506 2e-15
O65499284 Zinc finger protein ZAT3 no no 0.254 0.369 0.389 3e-14
Q9SIJ0270 Zinc finger protein ZAT2 no no 0.244 0.374 0.385 4e-14
Q9SSW0193 Zinc finger protein AZF3 no no 0.179 0.383 0.438 2e-13
Q9SSW1245 Zinc finger protein AZF1 no no 0.261 0.440 0.354 4e-13
O22533238 Zinc finger protein ZAT6 no no 0.256 0.445 0.382 4e-13
>sp|Q9M202|ZAT9_ARATH Zinc finger protein ZAT9 OS=Arabidopsis thaliana GN=ZAT9 PE=2 SV=1 Back     alignment and function desciption
 Score =  201 bits (511), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 147/371 (39%), Positives = 205/371 (55%), Gaps = 96/371 (25%)

Query: 38  MEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIPQKIQEEEEEREHRPHHQQLSFEIETES 97
           ME +KCR+CFK+F NG+ALGGHMRSHM N            E E RP   QLS+E E++ 
Sbjct: 1   MESYKCRVCFKSFVNGKALGGHMRSHMSN----------SHEEEQRP--SQLSYETESDV 48

Query: 98  ASSPSSSTSPSEEDDEEKSLFYGLRENPKRSIRLVDPEFSFGVVDASAAAAAAASASVVL 157
           +SS                                DP+F+F             ++SV+L
Sbjct: 49  SSS--------------------------------DPKFAF-------------TSSVLL 63

Query: 158 QDRESETESSKNP---TRRRSKRTRKLEQQHRQELDIIKKLKLNKSKNTIESSLWGHEPE 214
           +D ESE+ESS+N    TR+RSKRTRKL+        + KK+K         +S  G++PE
Sbjct: 64  EDGESESESSRNVINLTRKRSKRTRKLDS------FVTKKVK---------TSQLGYKPE 108

Query: 215 -----PVSSISDTTTEEDQQQHHHDLIMFRQQDDDEYEDEEAEKSMDETDESEEFK-SFN 268
                P SS SDTTTEED       L+M  +   D+++  ++ K + E  E+EE    +N
Sbjct: 109 SDQEPPHSSASDTTTEEDLA---FCLMMLSR---DKWKKNKSNKEVVEEIETEEESEGYN 162

Query: 269 NKNR--SRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLAS 326
             NR  ++G+YKCETC KVFKSYQALGGHRASHKK +    V   + +Q +     N+  
Sbjct: 163 KINRATTKGRYKCETCGKVFKSYQALGGHRASHKKNR----VSNNKTEQRSETEYDNVV- 217

Query: 327 PPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTGLVASTSARSASASTKLGENLIDLNLP 386
             +  K++HECP+C RVF+SGQALGGHKR+H  G ++    R    +  + + +IDLNLP
Sbjct: 218 --VVAKRIHECPICLRVFASGQALGGHKRSHGVGNLSVNQQRRVHRNESVKQRMIDLNLP 275

Query: 387 APIDDDDISQI 397
           AP ++D++S +
Sbjct: 276 APTEEDEVSVV 286




Probable transcription factor that may be involved in stress responses.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SHD0|ZAT4_ARATH Zinc finger protein ZAT4 OS=Arabidopsis thaliana GN=ZAT4 PE=2 SV=1 Back     alignment and function description
>sp|Q39092|ZAT1_ARATH Zinc finger protein ZAT1 OS=Arabidopsis thaliana GN=ZAT1 PE=2 SV=1 Back     alignment and function description
>sp|Q681X4|ZAT5_ARATH Zinc finger protein ZAT5 OS=Arabidopsis thaliana GN=ZAT5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSW2|AZF2_ARATH Zinc finger protein AZF2 OS=Arabidopsis thaliana GN=AZF2 PE=2 SV=1 Back     alignment and function description
>sp|O65499|ZAT3_ARATH Zinc finger protein ZAT3 OS=Arabidopsis thaliana GN=ZAT3 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIJ0|ZAT2_ARATH Zinc finger protein ZAT2 OS=Arabidopsis thaliana GN=ZAT2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSW0|AZF3_ARATH Zinc finger protein AZF3 OS=Arabidopsis thaliana GN=AZF3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SSW1|AZF1_ARATH Zinc finger protein AZF1 OS=Arabidopsis thaliana GN=AZF1 PE=2 SV=1 Back     alignment and function description
>sp|O22533|ZAT6_ARATH Zinc finger protein ZAT6 OS=Arabidopsis thaliana GN=ZAT6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
225453529359 PREDICTED: zinc finger protein ZAT9-like 0.815 0.938 0.550 2e-94
224063685332 predicted protein [Populus trichocarpa] 0.731 0.909 0.524 1e-92
356498260389 PREDICTED: zinc finger protein ZAT9-like 0.835 0.886 0.487 9e-75
356496320365 PREDICTED: zinc finger protein ZAT9-like 0.753 0.852 0.446 1e-74
358249138388 uncharacterized protein LOC100780611 [Gl 0.806 0.858 0.441 1e-74
297734535257 unnamed protein product [Vitis vinifera] 0.600 0.964 0.421 5e-67
224129930289 predicted protein [Populus trichocarpa] 0.539 0.771 0.567 1e-61
224138600315 predicted protein [Populus trichocarpa] 0.731 0.958 0.419 1e-57
449431964317 PREDICTED: zinc finger protein ZAT9-like 0.615 0.801 0.504 8e-53
359495992323 PREDICTED: zinc finger protein ZAT4-like 0.736 0.941 0.445 3e-51
>gi|225453529|ref|XP_002278670.1| PREDICTED: zinc finger protein ZAT9-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 219/398 (55%), Positives = 265/398 (66%), Gaps = 61/398 (15%)

Query: 38  MEKHKCRLCFKNFSNGRALGGHMRSHMLNLPIPQKIQEEEEEREHRPHHQQLSFEIETES 97
           MEKHKC+LCF++FSNGRALGGHMRSHMLNLPIP             P  +Q S   + E+
Sbjct: 1   MEKHKCKLCFRSFSNGRALGGHMRSHMLNLPIP-------------PKQEQPSQIGDDET 47

Query: 98  ASSPSSSTSPSEEDDEEKSLFYGLRENPKRSIRLVDPEFSFGVVDASAAAAAAASASVVL 157
            S+ SSS+S  E +D  K L Y LRENPK+SIRL DPEFSF V DA         ASVVL
Sbjct: 48  ESASSSSSSEEEGED--KGLGYELRENPKKSIRLADPEFSFAV-DA---------ASVVL 95

Query: 158 QDRESETESSKNPTRRRSKRTRKLEQQHRQELDIIKKLKLNKSKNTIESSLWGHEPEPVS 217
           QDRESETESSKNPTRRRSKR RKL           KK+KL+K   T ES  W  +PEPVS
Sbjct: 96  QDRESETESSKNPTRRRSKRNRKLGLADPPRFHEQKKIKLDKLSKT-ES--WA-DPEPVS 151

Query: 218 SISDTTTEEDQQQHHHDLIMFRQQDDDEYEDEE-----------------AEKSMDETDE 260
           SISD TTEED       +++ R +  +E E++E                  E+ +DETD+
Sbjct: 152 SISDATTEEDVA--FCLMMLSRDKWIEEQENQERRHDEEDEEEAEAEAEEEERFVDETDD 209

Query: 261 SEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGA 320
           S+E K F  K R+RGKYKCETC KVF+SYQALGGHRASHKKIK   P++E E + ENA  
Sbjct: 210 SDELKLF--KTRARGKYKCETCNKVFRSYQALGGHRASHKKIKACAPIKEVEFEPENA-- 265

Query: 321 SINLASPPLSVKKVHECPVCFRVFSSGQALGGHKRTHVTG-----LVASTSARSASASTK 375
               ++P L+  K+HECPVCFR F+SGQALGGHKR+H++G        +       AS+K
Sbjct: 266 ----SNPCLADAKIHECPVCFRKFTSGQALGGHKRSHISGSAAAAAAPAPPPPPRKASSK 321

Query: 376 LGENLIDLNLPAPIDDDDISQIELSAVSDAEFVNHIKR 413
           +G+++IDLNLPAPI++DDISQIE SAVSDAEFVN I+R
Sbjct: 322 VGDSMIDLNLPAPIEEDDISQIEHSAVSDAEFVNPIRR 359




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224063685|ref|XP_002301264.1| predicted protein [Populus trichocarpa] gi|222842990|gb|EEE80537.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356498260|ref|XP_003517971.1| PREDICTED: zinc finger protein ZAT9-like [Glycine max] Back     alignment and taxonomy information
>gi|356496320|ref|XP_003517016.1| PREDICTED: zinc finger protein ZAT9-like [Glycine max] Back     alignment and taxonomy information
>gi|358249138|ref|NP_001239999.1| uncharacterized protein LOC100780611 [Glycine max] gi|255641017|gb|ACU20788.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297734535|emb|CBI16586.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224129930|ref|XP_002320706.1| predicted protein [Populus trichocarpa] gi|222861479|gb|EEE99021.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224138600|ref|XP_002326643.1| predicted protein [Populus trichocarpa] gi|222833965|gb|EEE72442.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449431964|ref|XP_004133770.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis sativus] gi|449532473|ref|XP_004173205.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359495992|ref|XP_003635129.1| PREDICTED: zinc finger protein ZAT4-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query413
TAIR|locus:2055583314 AT2G45120 "AT2G45120" [Arabido 0.515 0.678 0.439 1.3e-49
TAIR|locus:2103311288 AT3G60580 "AT3G60580" [Arabido 0.520 0.746 0.373 1.4e-44
TAIR|locus:2205649267 AT1G02030 "AT1G02030" [Arabido 0.506 0.782 0.383 1.1e-42
TAIR|locus:2197890455 AT1G26610 "AT1G26610" [Arabido 0.142 0.129 0.559 4.7e-23
TAIR|locus:2161168304 AT5G61470 "AT5G61470" [Arabido 0.210 0.286 0.414 3.2e-20
TAIR|locus:2091201273 ZF2 "AT3G19580" [Arabidopsis t 0.200 0.304 0.5 5.8e-17
TAIR|locus:2122118284 DAZ2 "AT4G35280" [Arabidopsis 0.198 0.288 0.476 2.6e-16
TAIR|locus:2059672270 DAZ1 "AT2G17180" [Arabidopsis 0.186 0.285 0.456 1e-15
TAIR|locus:2083053215 AT3G49930 "AT3G49930" [Arabido 0.256 0.493 0.393 1.6e-15
TAIR|locus:2156435493 AT5G56200 "AT5G56200" [Arabido 0.208 0.174 0.447 1.8e-15
TAIR|locus:2055583 AT2G45120 "AT2G45120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 396 (144.5 bits), Expect = 1.3e-49, Sum P(2) = 1.3e-49
 Identities = 108/246 (43%), Positives = 136/246 (55%)

Query:   159 DRESETESSK-NPTRRRSKRTRKLEQQHRQELDXXXXXXXXXXXXTIESSLWGHEPEPVS 217
             D ESETESS+ NPTRRRSKRTRKL      + D            T + S    EPE  S
Sbjct:    91 DVESETESSRINPTRRRSKRTRKLGSF---DFDFEKLT-------TSQPSELVAEPEHHS 140

Query:   218 SISDTTTEEDQQQHHHDLIMFRQQXXXXXXXXXXXXXXXXTD-ESEEFKSFNNKNRSRGK 276
             S SDTTTEED       LIM  +                 TD +SE++KS    ++SRG+
Sbjct:   141 SASDTTTEEDLA---FCLIMLSRDKWKQQKKKKQRVEEDETDHDSEDYKS----SKSRGR 193

Query:   277 YKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHE 336
             +KCETC KVFKSYQALGGHRASHKK K       T+ +Q      + +       KKVHE
Sbjct:   194 FKCETCGKVFKSYQALGGHRASHKKNKACM----TKTEQVETEYVLGVKE-----KKVHE 244

Query:   337 CPVCFRVFSSGQALGGHKRTHVTGL-----VXXXXXXXXXXXXKLGENLIDLNLPAPIDD 391
             CP+CFRVF+SGQALGGHKR+H + +     +             + + +IDLNLPAP ++
Sbjct:   245 CPICFRVFTSGQALGGHKRSHGSNIGAGRGLSVSQIVQIEEEVSVKQRMIDLNLPAPNEE 304

Query:   392 DDISQI 397
             D+ S +
Sbjct:   305 DETSLV 310


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2103311 AT3G60580 "AT3G60580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205649 AT1G02030 "AT1G02030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197890 AT1G26610 "AT1G26610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161168 AT5G61470 "AT5G61470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091201 ZF2 "AT3G19580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122118 DAZ2 "AT4G35280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059672 DAZ1 "AT2G17180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083053 AT3G49930 "AT3G49930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156435 AT5G56200 "AT5G56200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 1e-05
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 2e-05
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 0.002
>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information
 Score = 41.4 bits (98), Expect = 1e-05
 Identities = 13/25 (52%), Positives = 15/25 (60%)

Query: 277 YKCETCKKVFKSYQALGGHRASHKK 301
           + C  C K F S QALGGH+ SH  
Sbjct: 2   HTCGVCGKTFSSLQALGGHKKSHCS 26


Length = 27

>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information
>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 413
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.89
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.89
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.76
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.73
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.48
KOG3576267 consensus Ovo and related transcription factors [T 99.48
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.24
KOG3576267 consensus Ovo and related transcription factors [T 99.2
KOG3608467 consensus Zn finger proteins [General function pre 99.16
KOG3608467 consensus Zn finger proteins [General function pre 99.14
PHA00733128 hypothetical protein 98.92
PHA0276855 hypothetical protein; Provisional 98.61
PHA0061644 hypothetical protein 98.53
PHA0276855 hypothetical protein; Provisional 98.46
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.38
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.37
PLN03086567 PRLI-interacting factor K; Provisional 98.32
PLN03086567 PRLI-interacting factor K; Provisional 98.22
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.19
KOG3993500 consensus Transcription factor (contains Zn finger 98.06
PHA0061644 hypothetical protein 98.04
PHA0073279 hypothetical protein 98.02
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.98
KOG3993500 consensus Transcription factor (contains Zn finger 97.98
PHA00733128 hypothetical protein 97.86
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.77
COG5189423 SFP1 Putative transcriptional repressor regulating 97.72
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.7
smart0035526 ZnF_C2H2 zinc finger. 97.65
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.61
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.37
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.29
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.23
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.21
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.19
PHA0073279 hypothetical protein 96.83
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.73
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.72
smart0035526 ZnF_C2H2 zinc finger. 96.44
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.25
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.8
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.5
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.48
PRK04860160 hypothetical protein; Provisional 95.38
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.12
PRK04860160 hypothetical protein; Provisional 95.06
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.05
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.13
KOG2893 341 consensus Zn finger protein [General function pred 92.23
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.75
COG5048467 FOG: Zn-finger [General function prediction only] 91.09
COG5048467 FOG: Zn-finger [General function prediction only] 90.68
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 90.0
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 89.9
KOG1146 1406 consensus Homeobox protein [General function predi 88.72
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 88.03
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 87.79
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 87.47
KOG2893341 consensus Zn finger protein [General function pred 86.13
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 85.25
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 83.2
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 80.58
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
Probab=99.89  E-value=1.2e-23  Score=212.86  Aligned_cols=92  Identities=18%  Similarity=0.307  Sum_probs=81.5

Q ss_pred             CCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCC----CccccC---CcCcccC
Q 044606          273 SRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVK----KVHECP---VCFRVFS  345 (413)
Q Consensus       273 ~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~----kp~~C~---~C~k~F~  345 (413)
                      ...|..|-+|.|+....+.|+.|.|+|+||+||+|++|+.+|+  .+.+|+.|+.+|...    -+|.|+   +|.+.|.
T Consensus       602 ~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFt--TkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kft  679 (958)
T KOG1074|consen  602 RTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFT--TKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFT  679 (958)
T ss_pred             cCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhc--cccchhhcccccccCccccccccCCchhhhccccc
Confidence            4467999999999999999999999999999999999999996  667888999888654    358999   9999999


Q ss_pred             CchhhcccccccccCCCCCCC
Q 044606          346 SGQALGGHKRTHVTGLVASTS  366 (413)
Q Consensus       346 ~~~~L~~H~r~H~~~~~~~~~  366 (413)
                      ..-.|..|+|+|.++..+...
T Consensus       680 n~V~lpQhIriH~~~~~s~g~  700 (958)
T KOG1074|consen  680 NAVTLPQHIRIHLGGQISNGG  700 (958)
T ss_pred             ccccccceEEeecCCCCCCCc
Confidence            999999999999977666543



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query413
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 4e-07
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 2e-06
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 54.9 bits (131), Expect = 3e-08
 Identities = 38/286 (13%), Positives = 80/286 (27%), Gaps = 84/286 (29%)

Query: 87  QQLSFEIETESASSPSSSTS-PSEEDDEEKSLFYGLRENP-KRSIRLV-----DPE---- 135
           Q+L ++I+    S    S++        +  L   L+  P +  + LV     + +    
Sbjct: 203 QKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCL-LVLLNVQNAKAWNA 261

Query: 136 FSFG---VV---DASAAAAAAASAS--VVLQDR-----ESETES--SKNPTRRRSKRTRK 180
           F+     ++           +A+ +  + L          E +S   K    R     R+
Sbjct: 262 FNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPRE 321

Query: 181 LEQQHRQELDII--------------KKLKLNKSKNTIESSLWGHEPEPVSSISDTTTEE 226
           +   + + L II              K +  +K    IESSL            +     
Sbjct: 322 VLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSL------------NVLEPA 369

Query: 227 DQQQHHHDLIMFRQQDD------------DEYEDEEAEKSMDETDESEEFKSFNNKNRSR 274
           + ++    L +F                  +    +    +++  +     S   K    
Sbjct: 370 EYRKMFDRLSVFP--PSAHIPTILLSLIWFDVIKSDVMVVVNKLHK----YSLVEKQPKE 423

Query: 275 GKYK-----CETCKKVFKSYQALGGHRASHKK-IKFYTPVQETELD 314
                     E   K+   Y         H+  +  Y   +  + D
Sbjct: 424 STISIPSIYLELKVKLENEYAL-------HRSIVDHYNIPKTFDSD 462


>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.91
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.87
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.85
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.82
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.81
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.8
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.79
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.78
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.7
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.62
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.62
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.6
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.6
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.58
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.58
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.53
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.53
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.52
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.51
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.51
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.51
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.5
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.5
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.49
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.46
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.45
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.45
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.45
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.44
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.44
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.39
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.39
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.38
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.38
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.36
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.35
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.34
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.34
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.34
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.33
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.33
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.31
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.31
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.3
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.3
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.29
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.29
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.26
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.23
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.21
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.17
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.16
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.13
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.1
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.1
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.09
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.03
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.03
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.98
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.97
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.97
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.96
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.96
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.95
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.95
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.93
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.93
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.93
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.93
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.92
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.91
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.91
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.9
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.9
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.9
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.89
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.89
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.89
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.88
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.88
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.88
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.88
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.88
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.87
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.87
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.87
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.86
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.86
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.86
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.85
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.85
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.85
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.84
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.84
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.84
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.83
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.83
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.83
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.83
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.83
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.83
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.82
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.82
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.82
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.82
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.81
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.81
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.79
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.78
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.76
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.73
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.72
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.71
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.71
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.69
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.68
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.67
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.67
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.67
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.65
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.64
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.64
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.64
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.63
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.63
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.62
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.62
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.04
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.6
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.59
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.59
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.58
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.58
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.58
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.0
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.56
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.53
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.52
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.51
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.5
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.86
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.47
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.46
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.41
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.41
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.41
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.4
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.38
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.33
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.32
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.31
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.3
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.29
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.27
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.25
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.22
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.21
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.48
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.48
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.18
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.17
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.46
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.14
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.14
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.11
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.1
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.07
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.01
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.0
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.0
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.85
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.79
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.66
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.07
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.02
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.55
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 93.98
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.77
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.91
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 88.89
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 84.98
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 84.23
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 83.01
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 82.7
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 81.7
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.03
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.91  E-value=2.6e-25  Score=198.39  Aligned_cols=109  Identities=20%  Similarity=0.322  Sum_probs=96.8

Q ss_pred             hhcccCcCcchHHHHHhhhhcCCCCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCC
Q 044606          251 AEKSMDETDESEEFKSFNNKNRSRGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLS  330 (413)
Q Consensus       251 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~  330 (413)
                      |..+...+.....+..|++.|.++++|.|.+|++.|.+...|..|+++|+++++|.|..|++.|.  ....|..|+++|+
T Consensus        80 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~--~~~~L~~H~~~H~  157 (190)
T 2i13_A           80 CPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFS--REDNLHTHQRTHT  157 (190)
T ss_dssp             CTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEES--CHHHHHHHHHHHH
T ss_pred             CcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccC--CHHHHHHHHHhcC
Confidence            33444566677889999999999999999999999999999999999999999999999999994  6778999999999


Q ss_pred             CCCccccCCcCcccCCchhhcccccccccCC
Q 044606          331 VKKVHECPVCFRVFSSGQALGGHKRTHVTGL  361 (413)
Q Consensus       331 g~kp~~C~~C~k~F~~~~~L~~H~r~H~~~~  361 (413)
                      ++++|.|++|++.|.+...|..|+++|+++.
T Consensus       158 ~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k  188 (190)
T 2i13_A          158 GEKPYKCPECGKSFSRRDALNVHQRTHTGKK  188 (190)
T ss_dssp             CCCCEECTTTCCEESSHHHHHHHHTTC----
T ss_pred             CCCCeECCCCCCccCCHHHHHHHHHhcCCCC
Confidence            9999999999999999999999999998763



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 413
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 6e-10
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 8e-10
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 9e-09
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 52.0 bits (125), Expect = 6e-10
 Identities = 12/25 (48%), Positives = 14/25 (56%)

Query: 333 KVHECPVCFRVFSSGQALGGHKRTH 357
           + + C  C R F S QALGGH   H
Sbjct: 4   RSYTCSFCKREFRSAQALGGHMNVH 28


>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query413
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.55
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.34
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.33
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.29
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.27
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.24
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.21
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.21
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.19
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.15
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.1
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.09
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.09
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.08
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.06
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.06
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 99.03
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.03
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.0
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.99
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.94
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.92
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.89
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.88
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.87
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.87
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.86
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.83
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.79
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.77
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.76
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.67
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.63
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.58
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.57
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.57
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.56
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.56
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.49
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.43
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.4
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.28
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.25
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.21
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.02
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.93
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.91
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.85
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.74
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.72
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.69
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.66
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.65
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.6
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.51
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.41
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.39
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.38
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.35
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.33
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.31
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.15
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.05
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.85
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.73
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.61
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.57
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.51
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.5
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.47
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.46
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.29
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.27
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.14
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.12
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.08
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.97
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.83
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.65
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.63
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.55
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.3
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.96
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.72
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.55
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.16
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.84
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.27
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.0
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.98
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.86
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.68
d1y0jb136 U-shaped transcription factor, different fingers { 92.42
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.74
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.57
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.35
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.24
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.02
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 89.87
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.87
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.92
d1y0jb136 U-shaped transcription factor, different fingers { 87.47
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 85.94
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 85.24
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 83.98
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 83.53
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.3
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 81.82
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 81.41
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.55  E-value=5.6e-16  Score=106.47  Aligned_cols=53  Identities=28%  Similarity=0.500  Sum_probs=47.1

Q ss_pred             CCccccCCccccccChhhhhhhhhhcCCCcccCCCCCCcccccccchhhhhhcCCCCCCCccccCCcCcccCCchhhccc
Q 044606          274 RGKYKCETCKKVFKSYQALGGHRASHKKIKFYTPVQETELDQENAGASINLASPPLSVKKVHECPVCFRVFSSGQALGGH  353 (413)
Q Consensus       274 ~~~~~C~~C~k~F~~~~~L~~H~~~H~~~kp~~C~~C~~~f~~~~~~~l~~h~~~h~g~kp~~C~~C~k~F~~~~~L~~H  353 (413)
                      +|||+|. ||++|....+|..|+++|+|                              ++||.|.+||++|.+.+.|..|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~------------------------------ekpy~C~~C~k~F~~~~~L~~H   49 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLG------------------------------LRPYGCGVCGKKFKMKHHLVGH   49 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSC------------------------------CCSEECTTTSCEESSSHHHHHH
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhcccc------------------------------ccCCcCCCcCCEecCHHHHHHH
Confidence            5789994 99999999999999999988                              6678888899999999999999


Q ss_pred             cccc
Q 044606          354 KRTH  357 (413)
Q Consensus       354 ~r~H  357 (413)
                      +++|
T Consensus        50 ~r~H   53 (53)
T d2csha1          50 MKIH   53 (53)
T ss_dssp             HTTT
T ss_pred             HhcC
Confidence            9987



>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure