Citrus Sinensis ID: 044616

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLNFLSINRFERKKNIDLALSAFAMLQNLEEDVFKNHNTADVTLTIA
cccEEEEcccccHHHHHHHcHHcccccccccEEEcccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEc
cccEEEEEcHHHHHHHHHHHHHHHHccccccEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHcHcHHHccccccEEEEEc
madmilvnSKFTANTFANTFKKLHArgirpavlypavnvdqlnflsiNRFERKKNIDLALSAFAMLQNLEEdvfknhntaDVTLTIA
MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLNFLSINRFERKKNIDLALSAFAMLQNLEedvfknhntadvtltia
MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLNFLSINRFERKKNIDLALSAFAMLQNLEEDVFKNHNTADVTLTIA
****ILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLNFLSINRFERKKNIDLALSAFAMLQNLEEDVFKNHNT********
MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLNFLSINRFERKKNIDLALSAFAM***************DVTLTIA
MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLNFLSINRFERKKNIDLALSAFAMLQNLEEDVFKNHNTADVTLTIA
*ADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLNFLSINRFERKKNIDLALSAFAMLQNLEEDVFKNHNTADVTLTIA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLNFLSINRFERKKNIDLALSAFAMLQNLEEDVFKNHNTADVTLTIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q9DBE8 415 Alpha-1,3/1,6-mannosyltra yes no 0.758 0.159 0.453 8e-12
O94738 455 Alpha-1,3/1,6-mannosyltra N/A no 0.850 0.162 0.404 3e-11
Q6CWQ0 503 Alpha-1,3/1,6-mannosyltra yes no 0.701 0.121 0.457 5e-11
Q9H553 416 Alpha-1,3/1,6-mannosyltra yes no 0.747 0.156 0.458 9e-11
Q6BVA4 476 Alpha-1,3/1,6-mannosyltra yes no 0.804 0.147 0.387 2e-09
Q59LF2 428 Alpha-1,3/1,6-mannosyltra N/A no 0.758 0.154 0.425 3e-09
P43636 503 Alpha-1,3/1,6-mannosyltra yes no 0.816 0.141 0.376 5e-08
Q755C1 514 Alpha-1,3/1,6-mannosyltra yes no 0.678 0.114 0.419 7e-08
Q6FJJ9 458 Alpha-1,3/1,6-mannosyltra yes no 0.701 0.133 0.392 1e-07
Q96WW6 506 Alpha-1,3/1,6-mannosyltra yes no 0.850 0.146 0.344 1e-07
>sp|Q9DBE8|ALG2_MOUSE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Mus musculus GN=Alg2 PE=2 SV=2 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 39/86 (45%), Positives = 49/86 (56%), Gaps = 20/86 (23%)

Query: 1   MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNV------------------DQL 42
           MAD ILVNS++TA+ F  TFK L  R   P VLYP++N+                   Q 
Sbjct: 169 MADRILVNSQYTASVFKETFKTLSHRN--PDVLYPSLNIGSFDLAIPEKIDDLVPKGKQF 226

Query: 43  NFLSINRFERKKNIDLALSAFAMLQN 68
            FLSINR+ERKKN+ LAL +   L+N
Sbjct: 227 LFLSINRYERKKNLPLALRSLVQLRN 252
Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 2EC: 5EC: 7
>sp|O94738|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1 Back     alignment and function description
>sp|Q6CWQ0|ALG2_KLULA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG2 PE=3 SV=1 Back     alignment and function description
>sp|Q9H553|ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens GN=ALG2 PE=1 SV=1 Back     alignment and function description
>sp|Q6BVA4|ALG2_DEBHA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG2 PE=3 SV=2 Back     alignment and function description
>sp|Q59LF2|ALG2_CANAL Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG2 PE=3 SV=1 Back     alignment and function description
>sp|P43636|ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG2 PE=1 SV=2 Back     alignment and function description
>sp|Q755C1|ALG2_ASHGO Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG2 PE=3 SV=1 Back     alignment and function description
>sp|Q6FJJ9|ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG2 PE=3 SV=1 Back     alignment and function description
>sp|Q96WW6|ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg2 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
225461697 408 PREDICTED: alpha-1,3/1,6-mannosyltransfe 1.0 0.213 0.747 2e-31
255569305 408 alpha-1,3-mannosyltransferase, putative 1.0 0.213 0.726 2e-30
224117020 413 predicted protein [Populus trichocarpa] 1.0 0.210 0.726 1e-29
302142886 396 unnamed protein product [Vitis vinifera] 0.850 0.186 0.780 5e-28
147777780 404 hypothetical protein VITISV_017764 [Viti 0.850 0.183 0.780 8e-28
449438921 407 PREDICTED: alpha-1,3/1,6-mannosyltransfe 1.0 0.213 0.673 2e-27
449524204 260 PREDICTED: alpha-1,3/1,6-mannosyltransfe 1.0 0.334 0.663 5e-27
449483289 314 PREDICTED: alpha-1,3/1,6-mannosyltransfe 1.0 0.277 0.684 1e-26
359807347 407 uncharacterized protein LOC100809168 [Gl 0.988 0.211 0.705 2e-26
356549651 407 PREDICTED: alpha-1,3/1,6-mannosyltransfe 0.977 0.208 0.691 2e-25
>gi|225461697|ref|XP_002285480.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like isoform 1 [Vitis vinifera] gi|359493768|ref|XP_003634662.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 71/95 (74%), Positives = 79/95 (83%), Gaps = 8/95 (8%)

Query: 1   MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQ--------LNFLSINRFER 52
           MAD+ILVNSKFTA+TFANTFK+L ARGIRPAVLYPAVNVDQ        LNFLSINRFER
Sbjct: 161 MADLILVNSKFTASTFANTFKRLDARGIRPAVLYPAVNVDQFDKPHAFKLNFLSINRFER 220

Query: 53  KKNIDLALSAFAMLQNLEEDVFKNHNTADVTLTIA 87
           KKNIDLA+SAFA+L++LEED     N AD +LTIA
Sbjct: 221 KKNIDLAISAFALLRSLEEDALGGQNFADASLTIA 255

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255569305|ref|XP_002525620.1| alpha-1,3-mannosyltransferase, putative [Ricinus communis] gi|223535056|gb|EEF36738.1| alpha-1,3-mannosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224117020|ref|XP_002317454.1| predicted protein [Populus trichocarpa] gi|222860519|gb|EEE98066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302142886|emb|CBI20181.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147777780|emb|CAN60300.1| hypothetical protein VITISV_017764 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449438921|ref|XP_004137236.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449524204|ref|XP_004169113.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483289|ref|XP_004156546.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359807347|ref|NP_001241379.1| uncharacterized protein LOC100809168 [Glycine max] gi|255642391|gb|ACU21459.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356549651|ref|XP_003543205.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
TAIR|locus:2037608 403 AT1G78800 [Arabidopsis thalian 0.931 0.200 0.673 9.7e-25
WB|WBGene00017282 400 F09E5.2 [Caenorhabditis elegan 0.356 0.077 0.656 3.7e-10
UNIPROTKB|F1NWX1 398 ALG2 "Uncharacterized protein" 0.931 0.203 0.428 6.7e-09
UNIPROTKB|Q9H553 416 ALG2 "Alpha-1,3/1,6-mannosyltr 0.747 0.156 0.494 2.6e-08
POMBASE|SPBC11B10.01 506 alg2 "mannosyltransferase comp 0.850 0.146 0.365 5.4e-07
ZFIN|ZDB-GENE-060502-2 455 alg2 "asparagine-linked glycos 0.781 0.149 0.445 5.9e-07
MGI|MGI:1914731 415 Alg2 "asparagine-linked glycos 0.781 0.163 0.428 8.3e-07
UNIPROTKB|G3V6U3 415 Alg2 "Asparagine-linked glycos 0.770 0.161 0.433 8.3e-07
SGD|S000003033 503 ALG2 "Mannosyltransferase in t 0.850 0.147 0.366 5e-06
UNIPROTKB|F6X6I6 416 ALG2 "Uncharacterized protein" 0.770 0.161 0.421 6.1e-06
TAIR|locus:2037608 AT1G78800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 282 (104.3 bits), Expect = 9.7e-25, P = 9.7e-25
 Identities = 64/95 (67%), Positives = 75/95 (78%)

Query:     1 MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQ--------LNFLSINRFER 52
             MADMILVNS FTA+TFANTFK+L+A+G RPAVLYPAVN+DQ        LNFLSINRFER
Sbjct:   161 MADMILVNSNFTASTFANTFKRLNAQGSRPAVLYPAVNIDQFIEPHTYKLNFLSINRFER 220

Query:    53 KKNIDLALSAFAMLQNLEEDVFKNHNTADVTLTIA 87
             KKNIDLA+SAFA+L   ++      N +DVTLT+A
Sbjct:   221 KKNIDLAVSAFAILCKHKQ------NLSDVTLTVA 249
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
WB|WBGene00017282 F09E5.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWX1 ALG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H553 ALG2 "Alpha-1,3/1,6-mannosyltransferase ALG2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPBC11B10.01 alg2 "mannosyltransferase complex subunit Alg2 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060502-2 alg2 "asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914731 Alg2 "asparagine-linked glycosylation 2 (alpha-1,3-mannosyltransferase)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6U3 Alg2 "Asparagine-linked glycosylation 2 homolog (Yeast, alpha-1,3-mannosyltransferase), isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
SGD|S000003033 ALG2 "Mannosyltransferase in the N-linked glycosylation pathway" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F6X6I6 ALG2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
cd03805 392 cd03805, GT1_ALG2_like, This family is most closel 2e-26
cd03809 365 cd03809, GT1_mtfB_like, This family is most closel 1e-04
cd03804 351 cd03804, GT1_wbaZ_like, This family is most closel 2e-04
cd03801 374 cd03801, GT1_YqgM_like, This family is most closel 4e-04
cd03806 419 cd03806, GT1_ALG11_like, This family is most close 6e-04
>gnl|CDD|99977 cd03805, GT1_ALG2_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information 
 Score = 99.6 bits (249), Expect = 2e-26
 Identities = 43/106 (40%), Positives = 52/106 (49%), Gaps = 27/106 (25%)

Query: 1   MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQLN----------------- 43
           MAD I+VNS FTA+ F  TF  L        V+YP V+ D                    
Sbjct: 154 MADKIVVNSNFTASVFKKTFPSLAKNPRE--VVYPCVDTDSFESTSEDPDPGLLIPKSGK 211

Query: 44  --FLSINRFERKKNIDLALSAFAMLQNLEEDVFKNHNTADVTLTIA 87
             FLSINRFERKKNI LA+ AFA+L++      K     +V L IA
Sbjct: 212 KTFLSINRFERKKNIALAIEAFAILKD------KLAEFKNVRLVIA 251

ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans. Length = 392
>gnl|CDD|99981 cd03809, GT1_mtfB_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99976 cd03804, GT1_wbaZ_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>gnl|CDD|99978 cd03806, GT1_ALG11_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
KOG1387 465 consensus Glycosyltransferase [Cell wall/membrane/ 99.81
PLN02949 463 transferase, transferring glycosyl groups 99.65
cd03806 419 GT1_ALG11_like This family is most closely related 99.53
KOG0853 495 consensus Glycosyltransferase [Cell wall/membrane/ 98.95
cd03805 392 GT1_ALG2_like This family is most closely related 98.89
cd03804 351 GT1_wbaZ_like This family is most closely related 98.85
cd03818 396 GT1_ExpC_like This family is most closely related 98.77
TIGR03449 405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 98.54
PRK15484 380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 98.49
cd04955 363 GT1_like_6 This family is most closely related to 98.46
cd04946 407 GT1_AmsK_like This family is most closely related 98.44
TIGR02149 388 glgA_Coryne glycogen synthase, Corynebacterium fam 98.43
cd05844 367 GT1_like_7 Glycosyltransferases catalyze the trans 98.42
cd03811 353 GT1_WabH_like This family is most closely related 98.41
cd03812 358 GT1_CapH_like This family is most closely related 98.38
cd03800 398 GT1_Sucrose_synthase This family is most closely r 98.37
cd03819 355 GT1_WavL_like This family is most closely related 98.37
cd04949 372 GT1_gtfA_like This family is most closely related 98.36
cd03809 365 GT1_mtfB_like This family is most closely related 98.36
PRK15427 406 colanic acid biosynthesis glycosyltransferase WcaL 98.34
cd03799 355 GT1_amsK_like This is a family of GT1 glycosyltran 98.33
PHA01633 335 putative glycosyl transferase group 1 98.32
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.32
TIGR03088 374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 98.28
cd03820 348 GT1_amsD_like This family is most closely related 98.27
cd03821 375 GT1_Bme6_like This family is most closely related 98.26
PHA01630 331 putative group 1 glycosyl transferase 98.22
cd03796 398 GT1_PIG-A_like This family is most closely related 98.21
TIGR02918 500 accessory Sec system glycosylation protein GtfA. M 98.19
cd03823 359 GT1_ExpE7_like This family is most closely related 98.17
cd03801 374 GT1_YqgM_like This family is most closely related 98.15
cd03807 365 GT1_WbnK_like This family is most closely related 98.13
cd04962 371 GT1_like_5 This family is most closely related to 98.13
cd03813 475 GT1_like_3 This family is most closely related to 98.12
cd03817 374 GT1_UGDG_like This family is most closely related 98.11
cd03798 377 GT1_wlbH_like This family is most closely related 98.08
cd03808 359 GT1_cap1E_like This family is most closely related 98.06
cd03822 366 GT1_ecORF704_like This family is most closely rela 98.05
TIGR03087 397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 98.02
cd03814 364 GT1_like_2 This family is most closely related to 97.97
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 97.96
PRK09922 359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 97.94
PRK10307 412 putative glycosyl transferase; Provisional 97.91
PRK00654 466 glgA glycogen synthase; Provisional 97.87
TIGR02472 439 sucr_P_syn_N sucrose-phosphate synthase, putative, 97.85
cd03794 394 GT1_wbuB_like This family is most closely related 97.82
cd03795 357 GT1_like_4 This family is most closely related to 97.79
cd04951 360 GT1_WbdM_like This family is most closely related 97.77
PRK10125 405 putative glycosyl transferase; Provisional 97.76
PRK14099 485 glycogen synthase; Provisional 97.75
PLN02871 465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 97.72
cd03792 372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 97.67
PLN02275 371 transferase, transferring glycosyl groups 97.66
cd03793 590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 97.64
TIGR02470 784 sucr_synth sucrose synthase. This model represents 97.62
cd03825 365 GT1_wcfI_like This family is most closely related 97.57
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 97.57
PF13439177 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 97.45
cd03816 415 GT1_ALG1_like This family is most closely related 97.45
TIGR02095 473 glgA glycogen/starch synthases, ADP-glucose type. 97.45
cd03791 476 GT1_Glycogen_synthase_DULL1_like This family is mo 97.36
PRK14098 489 glycogen synthase; Provisional 97.29
cd03788 460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 97.03
PLN02316 1036 synthase/transferase 97.01
PF00534 172 Glycos_transf_1: Glycosyl transferases group 1; In 96.99
cd03802 335 GT1_AviGT4_like This family is most closely relate 96.96
PLN02939 977 transferase, transferring glycosyl groups 96.76
PLN00142 815 sucrose synthase 96.6
TIGR02400 456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 96.34
PLN02501 794 digalactosyldiacylglycerol synthase 96.31
PLN02846 462 digalactosyldiacylglycerol synthase 96.0
COG0438 381 RfaG Glycosyltransferase [Cell envelope biogenesis 95.99
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 95.39
PRK05749 425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 95.09
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 94.34
cd04950 373 GT1_like_1 Glycosyltransferases catalyze the trans 94.23
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 93.91
PLN02605 382 monogalactosyldiacylglycerol synthase 92.63
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 92.44
TIGR03713 519 acc_sec_asp1 accessory Sec system protein Asp1. Th 92.1
TIGR02398 487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 91.94
PF05693 633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 91.73
PF13579160 Glyco_trans_4_4: Glycosyl transferase 4-like domai 91.35
cd03785 350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 87.03
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 84.03
PF12038168 DUF3524: Domain of unknown function (DUF3524); Int 83.63
TIGR02094 601 more_P_ylases alpha-glucan phosphorylases. This fa 82.78
>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information 
Probab=99.81  E-value=2.7e-20  Score=144.10  Aligned_cols=77  Identities=25%  Similarity=0.423  Sum_probs=67.1

Q ss_pred             CccEEEEcCHHHHHHHHHHhhccccCCCCCeEEcCCCcCCC------------ceEEEEeccccccCHH-HHHHHHHHcc
Q 044616            1 MADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQ------------LNFLSINRFERKKNID-LALSAFAMLQ   67 (87)
Q Consensus         1 ~ad~i~vNS~~T~~~i~~~~~~~~~~~~~~~VvYPpvd~~~------------~~~Lsv~r~~p~Kn~~-lai~Af~~l~   67 (87)
                      +||.+|+||+||++||.++|++.     +..+|||||+++.            +..||+|||+|||||. |+++|+....
T Consensus       222 ~ad~vm~NssWT~nHI~qiW~~~-----~~~iVyPPC~~e~lks~~~te~~r~~~ll~l~Q~RPEKnH~~Lql~Al~~~~  296 (465)
T KOG1387|consen  222 KADIVMTNSSWTNNHIKQIWQSN-----TCSIVYPPCSTEDLKSKFGTEGERENQLLSLAQFRPEKNHKILQLFALYLKN  296 (465)
T ss_pred             cceEEEecchhhHHHHHHHhhcc-----ceeEEcCCCCHHHHHHHhcccCCcceEEEEEeecCcccccHHHHHHHHHHhc
Confidence            58999999999999999999983     5899999999976            3799999999999999 8888888877


Q ss_pred             hhhhhhhhcCCCCceEEEEC
Q 044616           68 NLEEDVFKNHNTADVTLTIA   87 (87)
Q Consensus        68 ~~~~~~~~~~~~~~~~LVia   87 (87)
                      ..+.     ..+..++|+|+
T Consensus       297 ~pl~-----a~~~~iKL~iv  311 (465)
T KOG1387|consen  297 EPLE-----ASVSPIKLIIV  311 (465)
T ss_pred             Cchh-----hccCCceEEEE
Confidence            7763     35678899885

>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>PF13579 Glyco_trans_4_4: Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PF12038 DUF3524: Domain of unknown function (DUF3524); InterPro: IPR022701 This domain is functionally uncharacterised and is found in bacteria and eukaryotes Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
2f9f_A 177 First mannosyl transferase (WBAZ-1); alpha-beta pr 2e-07
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Length = 177 Back     alignment and structure
 Score = 44.9 bits (107), Expect = 2e-07
 Identities = 13/51 (25%), Positives = 20/51 (39%), Gaps = 7/51 (13%)

Query: 27 GIRPAVLYPAVNVDQLN-------FLSINRFERKKNIDLALSAFAMLQNLE 70
          G         V   +         +LS+NR   +K I+L L  F  LQ+ +
Sbjct: 2  GHHHHHHSHPVETSKFKFKCYGDFWLSVNRIYPEKRIELQLEVFKKLQDEK 52

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 98.69
2iw1_A 374 Lipopolysaccharide core biosynthesis protein RFAG; 98.67
3oy2_A 413 Glycosyltransferase B736L; rossmann fold, GDP-mann 98.65
3c48_A 438 Predicted glycosyltransferases; retaining glycosyl 98.59
3fro_A 439 GLGA glycogen synthase; glycosyltransferase family 98.56
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 98.53
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 98.48
2r60_A 499 Glycosyl transferase, group 1; rossmann-fold; 1.80 98.46
2qzs_A 485 Glycogen synthase; glycosyl-transferase, GT-B fold 98.35
1rzu_A 485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 98.34
2x0d_A 413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 98.33
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 98.23
3vue_A 536 GBSS-I, granule-bound starch synthase 1, chloropla 98.08
3s28_A 816 Sucrose synthase 1; glycosyltransferase, sucrose m 98.07
2x6q_A 416 Trehalose-synthase TRET; biosynthetic protein; 2.2 97.96
3beo_A 375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 97.32
3nb0_A 725 Glycogen [starch] synthase isoform 2; glycogen syn 97.19
1vgv_A 384 UDP-N-acetylglucosamine 2-epimerase; structural ge 96.99
2hy7_A 406 Glucuronosyltransferase GUMK; glycosyltransferases 96.93
3qhp_A 166 Type 1 capsular polysaccharide biosynthesis prote 96.86
3t5t_A 496 Putative glycosyltransferase; GTB fold, pseudoglyc 96.81
2bfw_A 200 GLGA glycogen synthase; glycosyltransferase family 96.45
1uqt_A 482 Alpha, alpha-trehalose-phosphate synthase; glycosy 96.27
1v4v_A 376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 96.27
2f9f_A 177 First mannosyl transferase (WBAZ-1); alpha-beta pr 96.06
2xci_A 374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 95.71
1f0k_A 364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 93.34
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 92.55
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
Probab=98.69  E-value=4.4e-08  Score=69.96  Aligned_cols=65  Identities=18%  Similarity=0.208  Sum_probs=55.9

Q ss_pred             ccEEEEcCHHHHHHHHHHhhccccCCCCCeEEcCCCcCCC----------------------ceEEEEeccccccCHHHH
Q 044616            2 ADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQ----------------------LNFLSINRFERKKNIDLA   59 (87)
Q Consensus         2 ad~i~vNS~~T~~~i~~~~~~~~~~~~~~~VvYPpvd~~~----------------------~~~Lsv~r~~p~Kn~~la   59 (87)
                      ||.+++.|+++++.+.+.++...    +..|+++++|.+.                      +.++++||+.+.|+++.+
T Consensus       141 ~d~ii~~s~~~~~~~~~~~~~~~----~~~vi~ngv~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~G~~~~~Kg~~~l  216 (394)
T 3okp_A          141 VDVLTYISQYTLRRFKSAFGSHP----TFEHLPSGVDVKRFTPATPEDKSATRKKLGFTDTTPVIACNSRLVPRKGQDSL  216 (394)
T ss_dssp             CSEEEESCHHHHHHHHHHHCSSS----EEEECCCCBCTTTSCCCCHHHHHHHHHHTTCCTTCCEEEEESCSCGGGCHHHH
T ss_pred             CCEEEEcCHHHHHHHHHhcCCCC----CeEEecCCcCHHHcCCCCchhhHHHHHhcCCCcCceEEEEEeccccccCHHHH
Confidence            79999999999999999986421    4678999998753                      259999999999999999


Q ss_pred             HHHHHHcchhh
Q 044616           60 LSAFAMLQNLE   70 (87)
Q Consensus        60 i~Af~~l~~~~   70 (87)
                      ++|++.+.++.
T Consensus       217 i~a~~~l~~~~  227 (394)
T 3okp_A          217 IKAMPQVIAAR  227 (394)
T ss_dssp             HHHHHHHHHHS
T ss_pred             HHHHHHHHhhC
Confidence            99999997664
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d2f9fa1 166 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ 0.003
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: First mannosyl transferase WbaZ
species: Archaeoglobus fulgidus [TaxId: 2234]

 Score = 32.5 bits (72), Expect = 0.003
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 44 FLSINRFERKKNIDLALSAFAMLQN 68
          +LS+NR   +K I+L L  F  LQ+
Sbjct: 15 WLSVNRIYPEKRIELQLEVFKKLQD 39

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d2iw1a1 370 Lipopolysaccharide core biosynthesis protein RfaG 98.3
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 97.85
d2f9fa1 166 First mannosyl transferase WbaZ {Archaeoglobus ful 97.62
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 96.94
d2bfwa1 196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.7
d1uqta_ 456 Trehalose-6-phosphate synthase, OtsA {Escherichia 95.84
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Lipopolysaccharide core biosynthesis protein RfaG
species: Escherichia coli [TaxId: 562]

Probab=98.30  E-value=1.1e-06  Score=59.45  Aligned_cols=67  Identities=16%  Similarity=0.232  Sum_probs=55.7

Q ss_pred             ccEEEEcCHHHHHHHHHHhhccccCCCCCeEEcCCCcCCC-----------------------ceEEEEeccccccCHHH
Q 044616            2 ADMILVNSKFTANTFANTFKKLHARGIRPAVLYPAVNVDQ-----------------------LNFLSINRFERKKNIDL   58 (87)
Q Consensus         2 ad~i~vNS~~T~~~i~~~~~~~~~~~~~~~VvYPpvd~~~-----------------------~~~Lsv~r~~p~Kn~~l   58 (87)
                      ++.+++.|++....+.+.++....   ...++++++|++.                       +.++++||+.++|+++.
T Consensus       136 ~~~~~~~~~~~~~~~~~~~~~~~~---~i~vi~~gv~~~~~~~~~~~~~~~~~r~~~~~~~~~~~i~~~gr~~~~Kg~~~  212 (370)
T d2iw1a1         136 STKLMMLTDKQIADFQKHYQTEPE---RFQILPPGIYPDRKYSEQIPNSREIYRQKNGIKEQQNLLLQVGSDFGRKGVDR  212 (370)
T ss_dssp             CCEEEESCHHHHHHHHHHHCCCGG---GEEECCCCCCGGGSGGGSCTTHHHHHHHHTTCCTTCEEEEEECSCTTTTTHHH
T ss_pred             CceEEEecHHHHHHHHHhcCCCcc---eEEEEEeecccccccccCchhhhhhhhhccCCCccceEEEEEeccccccchhh
Confidence            578999999999999998875432   3578899888643                       25999999999999999


Q ss_pred             HHHHHHHcchhhh
Q 044616           59 ALSAFAMLQNLEE   71 (87)
Q Consensus        59 ai~Af~~l~~~~~   71 (87)
                      +++|++.|.++..
T Consensus       213 li~a~~~l~~~~~  225 (370)
T d2iw1a1         213 SIEALASLPESLR  225 (370)
T ss_dssp             HHHHHHTSCHHHH
T ss_pred             hcccccccccccc
Confidence            9999999987764
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure