Citrus Sinensis ID: 044617


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MADVVVVFDFDRTLIDDDSDNWVVTQMGLTHLFNQLRSTLPWNSLMDRMMKELHSQGKTVEDIANCLRQCPLDSHVAAAIKSAHSLGCDLKIVSDANQFYIETIMEHHGLLGCFSEIYTNPTYVDEQGRLRILPYHDSTLSHHGCNLCPSNLCKGFVLDHVCTSFGCGKQRFIYLGDGRGDFCPTLKLRDCDFVMPRKNYPLWDRICSNPMLIKAKVHEWSSAEELKKILLHLIGAISIKEDVDSTVSSQPNSSECRSQTMPVYS
cccEEEEEEcccccccccccHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHccccccccEEECcccCCcccccEEEECcccccccccccccccccccHHHHHHHHHHHccccccEEEEEcccccccHHccccccccEEECcccccHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccc
MADVVVVFDFDRTLIDDDSDNWVVTQMGLTHLFNQLRSTLPWNSLMDRMMKELHSQGKTVEDIANCLRQCPLDSHVAAAIKSAHSLGCDLKIVSDANQFYIETIMEHHGLLGCFSEIYTNPTYVDEQGRLRILPYHDSTLSHHGCNLCPSNLCKGFVLDHVCTSFGCGKQRFIYLGDGRGDFCPTLKLRDCDFVMPRKNYPLWDRICSNPMLIKAKVHEWSSAEELKKILLHLIGAISI***************ECRSQTMP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADVVVVFDFDRTLIDDDSDNWVVTQMGLTHLFNQLRSTLPWNSLMDRMMKELHSQGKTVEDIANCLRQCPLDSHVAAAIKSAHSLGCDLKIVSDANQFYIETIMEHHGLLGCFSEIYTNPTYVDEQGRLRILPYHDSTLSHHGCNLCPSNLCKGFVLDHVCTSFGCGKQRFIYLGDGRGDFCPTLKLRDCDFVMPRKNYPLWDRICSNPMLIKAKVHEWSSAEELKKILLHLIGAISIKEDVDSTVSSQPNSSECRSQTMPVYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inorganic pyrophosphatase 3 Catalyzes the specific cleavage of pyrophosphate.probableQ9SU92
Pyridoxal phosphate phosphatase PHOSPHO2 Phosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). Also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate.probableQ9D9M5
Pyridoxal phosphate phosphatase PHOSPHO2 Phosphatase that has high activity toward pyridoxal 5'-phosphate (PLP). Also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate.probableQ66HC4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FEA, chain A
Confidence level:confident
Coverage over the Query: 2-233
View the alignment between query and template
View the model in PyMOL
Template: 1Y8A, chain A
Confidence level:confident
Coverage over the Query: 2-236
View the alignment between query and template
View the model in PyMOL