Citrus Sinensis ID: 044618

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASLYG
cccccccEEEEEEEEEcccccccccccccccccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEcccccEEEEEEEcccccccc
cccccccEEEEEEEEHcccccccccHHHcccHHHcccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEccccEEEEEccccccHHcc
YHVPAGTQLFVNAWkiqrdpsvweepcqfqperfLTRYkdidvrgqnfelipfgsgrrmcpavsLGLQVVQLTLASLVHafdfttpsdepvdmGEAMGLAIakatplevilsprlsaslyg
yhvpagtqlfvnawkiqrdpsvweepCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAkatplevilsprlsaslyg
YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASLYG
******TQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTP******MGEAMGLAIAKATPLEVIL**********
YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASLY*
YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASLYG
YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASLY*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASLYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
O49858527 Cytochrome P450 82A3 OS=G no no 0.991 0.227 0.591 5e-41
O49859525 Cytochrome P450 82A4 OS=G no no 0.991 0.228 0.583 8e-40
Q9SZ46524 Cytochrome P450 82C4 OS=A yes no 0.991 0.229 0.611 1e-38
O49396512 Cytochrome P450 82C3 OS=A no no 0.991 0.234 0.603 2e-38
Q43068544 Cytochrome P450 82A1 (Fra N/A no 0.991 0.220 0.558 3e-38
O49394523 Cytochrome P450 82C2 OS=A no no 0.991 0.229 0.595 7e-37
O81972522 Cytochrome P450 82A2 OS=G no no 0.991 0.229 0.55 2e-35
P48418506 Flavonoid 3',5'-hydroxyla N/A no 0.991 0.237 0.508 1e-31
P48419508 Flavonoid 3',5'-hydroxyla N/A no 1.0 0.238 0.504 3e-31
P37120513 Flavonoid 3',5'-hydroxyla N/A no 0.991 0.233 0.491 5e-31
>sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 Back     alignment and function desciption
 Score =  166 bits (419), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 90/120 (75%)

Query: 1   YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMC 60
           YH+  GT+L  N WKI RDPSVW +P +F+PERFLT +KD+D+RG NFEL+PFGSGRR+C
Sbjct: 405 YHIKKGTRLIHNLWKIHRDPSVWSDPLEFKPERFLTTHKDVDLRGHNFELLPFGSGRRVC 464

Query: 61  PAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASLY 120
             +SLGL +V  TLA+L+H+FD   PS EPVDM E  G    KATPLE+++ PR S + Y
Sbjct: 465 AGMSLGLNMVHFTLANLLHSFDILNPSAEPVDMTEFFGFTNTKATPLEILVKPRQSPNYY 524

Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 Back     alignment and function description
>sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 Back     alignment and function description
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function description
>sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 Back     alignment and function description
>sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 Back     alignment and function description
>sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 Back     alignment and function description
>sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 Back     alignment and function description
>sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
359492645 731 PREDICTED: cytochrome P450 82A3 [Vitis v 0.991 0.164 0.658 6e-45
225458465 527 PREDICTED: cytochrome P450 82C4 [Vitis v 1.0 0.229 0.669 2e-44
356510322 526 PREDICTED: cytochrome P450 82C4-like [Gl 0.991 0.228 0.702 1e-43
224137318 392 cytochrome P450 [Populus trichocarpa] gi 1.0 0.308 0.677 3e-43
302142408 929 unnamed protein product [Vitis vinifera] 0.983 0.128 0.655 1e-42
225458444 554 PREDICTED: cytochrome P450 82A3-like [Vi 0.983 0.214 0.655 1e-42
297745692 543 unnamed protein product [Vitis vinifera] 0.991 0.220 0.658 6e-42
225468906 528 PREDICTED: cytochrome P450 82C4 [Vitis v 0.991 0.227 0.658 6e-42
356537774 538 PREDICTED: cytochrome P450 82A3-like [Gl 0.991 0.223 0.641 9e-42
356518070 444 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.991 0.270 0.677 1e-41
>gi|359492645|ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  184 bits (467), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 79/120 (65%), Positives = 100/120 (83%)

Query: 1   YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMC 60
           YH+PAGT+L  N WKI RDPS+W +P +F+PERFLT +KD+DV+GQ+FELIPFGSGRR+C
Sbjct: 611 YHIPAGTRLLANLWKIHRDPSIWSDPDEFRPERFLTTHKDVDVKGQHFELIPFGSGRRIC 670

Query: 61  PAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASLY 120
           P +S GLQ +Q TLASL+  F+F T SDEPVDM E++GL   KATPLEV+++PRLS+ LY
Sbjct: 671 PGISFGLQFMQFTLASLIQGFEFATMSDEPVDMTESIGLTNLKATPLEVLVAPRLSSDLY 730

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225458465|ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|302142392|emb|CBI19595.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356510322|ref|XP_003523888.1| PREDICTED: cytochrome P450 82C4-like [Glycine max] Back     alignment and taxonomy information
>gi|224137318|ref|XP_002327096.1| cytochrome P450 [Populus trichocarpa] gi|222835411|gb|EEE73846.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|302142408|emb|CBI19611.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458444|ref|XP_002282014.1| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745692|emb|CBI40977.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225468906|ref|XP_002268915.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|147794787|emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356537774|ref|XP_003537400.1| PREDICTED: cytochrome P450 82A3-like [Glycine max] Back     alignment and taxonomy information
>gi|356518070|ref|XP_003527707.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
TAIR|locus:2116607524 CYP82C4 ""cytochrome P450, fam 0.991 0.229 0.611 3.5e-36
TAIR|locus:2116622512 CYP82C3 ""cytochrome P450, fam 0.991 0.234 0.603 3.5e-36
TAIR|locus:2116652523 CYP82C2 ""cytochrome P450, fam 0.991 0.229 0.595 1.7e-34
TAIR|locus:2040174527 CYP82F1 ""cytochrome P450, fam 0.983 0.225 0.571 5.8e-34
TAIR|locus:2090275515 CYP82G1 "cytochrome P450, fami 0.975 0.229 0.508 1.3e-28
TAIR|locus:2012673368 CYP76C5 ""cytochrome P450, fam 0.867 0.285 0.527 1.3e-27
TAIR|locus:2139099520 CYP706A5 ""cytochrome P450, fa 0.966 0.225 0.449 4.1e-26
TAIR|locus:2142878513 TT7 "TRANSPARENT TESTA 7" [Ara 1.0 0.235 0.452 1.1e-25
TAIR|locus:2058440508 CYP98A3 "cytochrome P450, fami 0.975 0.232 0.422 1.3e-25
TAIR|locus:2043605512 CYP76C2 ""cytochrome P450, fam 0.892 0.210 0.495 1.8e-25
TAIR|locus:2116607 CYP82C4 ""cytochrome P450, family 82, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 390 (142.3 bits), Expect = 3.5e-36, P = 3.5e-36
 Identities = 74/121 (61%), Positives = 90/121 (74%)

Query:     1 YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLT-RYKDIDVRGQNFELIPFGSGRRM 59
             Y+VP GT+L VN WKIQRDP V+ EP +F+PERF+T   K+ DVRGQNFEL+PFGSGRR 
Sbjct:   403 YYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRS 462

Query:    60 CPAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRLSASL 119
             CP  SL +QV+ L LA  +H+FD  T  D PVDM E  GL I KATPLEV++SPR+   L
Sbjct:   463 CPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGLTIPKATPLEVLISPRIKEEL 522

Query:   120 Y 120
             +
Sbjct:   523 F 523
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IDA
GO:0071281 "cellular response to iron ion" evidence=IEP
GO:0010043 "response to zinc ion" evidence=RCA
TAIR|locus:2116622 CYP82C3 ""cytochrome P450, family 82, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116652 CYP82C2 ""cytochrome P450, family 82, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040174 CYP82F1 ""cytochrome P450, family 82, subfamily F, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090275 CYP82G1 "cytochrome P450, family 82, subfamily G, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012673 CYP76C5 ""cytochrome P450, family 76, subfamily C, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139099 CYP706A5 ""cytochrome P450, family 706, subfamily A, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142878 TT7 "TRANSPARENT TESTA 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058440 CYP98A3 "cytochrome P450, family 98, subfamily A, polypeptide 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-44
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-44
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 3e-31
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-30
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 5e-29
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 6e-25
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 6e-24
pfam00067461 pfam00067, p450, Cytochrome P450 7e-21
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 7e-21
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 5e-17
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 3e-14
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-12
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 5e-12
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-11
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 4e-11
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 9e-10
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 8e-08
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 3e-07
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 2e-06
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 3e-04
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 0.001
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 0.004
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score =  150 bits (381), Expect = 2e-44
 Identities = 60/126 (47%), Positives = 81/126 (64%), Gaps = 5/126 (3%)

Query: 1   YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLT--RYKDIDVRGQNFELIPFGSGRR 58
           YH+P G  L VN W I RDP  W +P +F+P+RFL    +  +DV+G +FELIPFG+GRR
Sbjct: 390 YHIPKGATLLVNVWAIARDPEQWPDPLEFRPDRFLPGGEHAGVDVKGSDFELIPFGAGRR 449

Query: 59  MCPAVSLGLQVVQLTLASLVHAFDFTTPSD---EPVDMGEAMGLAIAKATPLEVILSPRL 115
           +C  +S GL++V L  A+LVHAFD+        + ++M EA GL + +A PL V   PRL
Sbjct: 450 ICAGLSWGLRMVTLLTATLVHAFDWELADGQTPDKLNMEEAYGLTLQRAVPLMVHPRPRL 509

Query: 116 SASLYG 121
             S YG
Sbjct: 510 LPSAYG 515

Length = 517
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.98
PLN02971543 tryptophan N-hydroxylase 99.97
PLN02394503 trans-cinnamate 4-monooxygenase 99.97
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.97
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.97
PLN02738633 carotene beta-ring hydroxylase 99.97
PTZ00404482 cytochrome P450; Provisional 99.97
PLN00168519 Cytochrome P450; Provisional 99.97
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.97
PLN03234499 cytochrome P450 83B1; Provisional 99.97
PLN03112514 cytochrome P450 family protein; Provisional 99.97
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.97
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.97
PLN02183516 ferulate 5-hydroxylase 99.97
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.96
PLN02687517 flavonoid 3'-monooxygenase 99.96
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.96
PLN02290516 cytokinin trans-hydroxylase 99.96
PLN02936489 epsilon-ring hydroxylase 99.96
PLN03018534 homomethionine N-hydroxylase 99.96
PLN02655466 ent-kaurene oxidase 99.96
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.96
PLN02500490 cytochrome P450 90B1 99.96
PLN02966502 cytochrome P450 83A1 99.96
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.96
PLN02302490 ent-kaurenoic acid oxidase 99.96
PLN02774463 brassinosteroid-6-oxidase 99.96
PLN02196463 abscisic acid 8'-hydroxylase 99.96
PLN02987472 Cytochrome P450, family 90, subfamily A 99.95
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.95
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.91
PLN02648480 allene oxide synthase 99.89
PF0849259 SRP72: SRP72 RNA-binding domain; InterPro: IPR0136 82.45
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.98  E-value=1.7e-32  Score=201.08  Aligned_cols=110  Identities=27%  Similarity=0.549  Sum_probs=96.1

Q ss_pred             CccCCCCEEeechhhhccCCCCCCCCCCCCCCCcCCCCCCccccCCccceeeccCCCCCCCchHHHHHHHHHHHHHHHHh
Q 044618            1 YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHA   80 (121)
Q Consensus         1 ~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~~~la~ll~~   80 (121)
                      |.||||+.|.++.+++||||++||||++|+||||.+++.+   ...+..|+|||.|+|.|+|++||++|+|+.|++||++
T Consensus       387 ~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~---~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~  463 (499)
T KOG0158|consen  387 FVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNK---SRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLRN  463 (499)
T ss_pred             eEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCccc---ccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHhh
Confidence            5799999999999999999999999999999999987632   2368899999999999999999999999999999999


Q ss_pred             ceeeCCCCCCCCCcccc---ceeeccCCCeEEEEEeCC
Q 044618           81 FDFTTPSDEPVDMGEAM---GLAIAKATPLEVILSPRL  115 (121)
Q Consensus        81 f~~~~~~~~~~~~~~~~---~~~~~~~~~~~v~~~~r~  115 (121)
                      |+++..+. .+.. ...   +.++.|+.++++.+++|.
T Consensus       464 f~~~~~~~-t~~~-~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  464 FSFEVCPT-TIIP-LEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             CEEecCCc-ccCc-ccCCccceeeecCCceEEEEEeCC
Confidence            99999873 3222 233   677888899999999984

>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PF08492 SRP72: SRP72 RNA-binding domain; InterPro: IPR013699 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 3e-13
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 8e-13
3pm0_A507 Structural Characterization Of The Complex Between 5e-12
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 6e-11
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 6e-11
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-09
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 2e-09
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-09
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 3e-09
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 4e-09
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 1e-08
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 5e-08
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 9e-08
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 9e-08
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 9e-08
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 4e-07
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 8e-07
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 8e-07
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 1e-06
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-06
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 1e-06
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 1e-06
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 1e-06
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 1e-06
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 1e-06
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-06
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 1e-06
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 1e-06
1fah_A471 Structure Of Cytochrome P450 Length = 471 1e-06
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-06
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 1e-06
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 1e-06
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 1e-06
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-06
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-06
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-06
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-06
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 2e-06
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 2e-06
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-06
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 2e-06
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 3e-06
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 3e-06
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 3e-06
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 3e-06
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-06
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 6e-06
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 6e-06
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 6e-06
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 6e-06
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 6e-06
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 6e-06
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 6e-06
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-05
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 1e-05
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-05
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-05
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 4e-05
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 4e-05
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 4e-05
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 4e-05
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 4e-05
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 4e-05
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 4e-05
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 5e-05
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-05
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 2e-04
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 2e-04
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 2e-04
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-04
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 2e-04
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 2e-04
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 2e-04
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 4e-04
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 4e-04
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 5e-04
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure 
Iteration: 1

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 56/104 (53%)
Query: 1   YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMC 60
           +++P    +FVN W++  DP +WE+P +F+PERFLT       +  + +++ FG G+R C
Sbjct: 375 FYIPKKCCVFVNQWQVNHDPELWEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRC 434
Query: 61  PAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKA 104
               L    + L LA L+   +F+ P    VD+    GL +  A
Sbjct: 435 IGEVLAKWEIFLFLAILLQQLEFSVPPGVKVDLTPIYGLTMKHA 478
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-47
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-40
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 3e-40
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-37
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 5e-27
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-25
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-24
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-24
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-24
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-24
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-24
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-23
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 6e-22
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-21
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 6e-21
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 9e-21
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-20
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 5e-20
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 5e-20
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 5e-20
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 9e-20
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-18
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-18
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 6e-17
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 8e-17
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-15
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-14
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 6e-14
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 8e-14
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  156 bits (397), Expect = 3e-47
 Identities = 31/129 (24%), Positives = 52/129 (40%), Gaps = 11/129 (8%)

Query: 1   YHVPAGTQLFVNAW-KIQRDPSVWEEPCQFQPERFL----TRYKDIDVRGQ--NFELIPF 53
           YH+  G +L V  +   Q DP + ++P  FQ +RFL    T  KD    G    +  +P+
Sbjct: 346 YHLRRGDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNADRTEKKDFFKNGARVKYPSVPW 405

Query: 54  GSGRRMCPAVSLGLQVVQLTLASLVHAFDFTTPSD---EPVDMGEAMGLAIA-KATPLEV 109
           G+   +CP     +  ++  + +++  FD          P+      G  I   A  LE+
Sbjct: 406 GTEDNLCPGRHFAVHAIKELVFTILTRFDVELCDKNATVPLVDPSRYGFGILQPAGDLEI 465

Query: 110 ILSPRLSAS 118
               R    
Sbjct: 466 RYRIRFHHH 474
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.97
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.97
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.97
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.97
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.97
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.97
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.97
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.97
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.97
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.97
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.97
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.97
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.97
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.97
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.97
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.97
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.97
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.96
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.96
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.96
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.96
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.96
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.96
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.95
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.95
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.95
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.95
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.95
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.95
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.95
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.95
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.94
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.94
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.94
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.94
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.94
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.94
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.94
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.94
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.94
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.94
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.94
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.94
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.94
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.94
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.94
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.94
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.94
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.94
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.94
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.94
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.94
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.93
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.93
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.93
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.93
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.93
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.93
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.93
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.93
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.93
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.93
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.93
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.93
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.93
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.93
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.93
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.93
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.93
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.92
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.92
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.91
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.91
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.91
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.91
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.88
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-34  Score=208.60  Aligned_cols=113  Identities=29%  Similarity=0.604  Sum_probs=94.3

Q ss_pred             CccCCCCEEeechhhhccCCCCCCCCCCCCCCCcCCCCCCccccCCccceeeccCCCCCCCchHHHHHHHHHHHHHHHHh
Q 044618            1 YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHA   80 (121)
Q Consensus         1 ~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~~~la~ll~~   80 (121)
                      |.|||||.|.++.+++|+||++|+||++|+||||++++.+.   ..+..|+|||+|+|.|+|++||++|+++++|.||++
T Consensus       365 ~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~---~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~  441 (479)
T 3tbg_A          365 FRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHF---VKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQH  441 (479)
T ss_dssp             EEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCB---CCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHH
T ss_pred             EEecCCCeeeechhhhcCChhhCCCccccCccccCCCCccc---CCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHc
Confidence            57999999999999999999999999999999999865322   256789999999999999999999999999999999


Q ss_pred             ceeeCCCCCCC-CCccccceeeccCCCeEEEEEeCCCC
Q 044618           81 FDFTTPSDEPV-DMGEAMGLAIAKATPLEVILSPRLSA  117 (121)
Q Consensus        81 f~~~~~~~~~~-~~~~~~~~~~~~~~~~~v~~~~r~~~  117 (121)
                      |++++++++.. ......+++..| .++.|++++|++.
T Consensus       442 f~~~~~~~~~~~~~~~~~~~~~~P-~~~~v~~~pRs~~  478 (479)
T 3tbg_A          442 FSFSVPTGQPRPSHHGVFAFLVSP-SPYELCAVPRHHH  478 (479)
T ss_dssp             EEEECCTTSCCCCSCEEESSSEEE-CCCCBEEEEC---
T ss_pred             cEEEeCCCCCCccccccceeeecC-CCeEEEEEECCCC
Confidence            99999877543 233334556656 4899999999863
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-29
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-28
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-26
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-23
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-23
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-21
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-17
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 1e-15
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 4e-15
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 9e-14
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-13
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 6e-13
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 9e-13
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 2e-12
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-12
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 2e-11
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-10
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-10
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 5e-10
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-09
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 1e-08
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  107 bits (268), Expect = 2e-29
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 4/114 (3%)

Query: 1   YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMC 60
           Y +P GT +  N + +  D   W +P  F PERFL          +   L+PF  GRR C
Sbjct: 353 YSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGY---FAKKEALVPFSLGRRHC 409

Query: 61  PAVSLGLQVVQLTLASLVHAFDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPR 114
               L    + L   +L+  F    P +   D+   +G+ + +  P  +    R
Sbjct: 410 LGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLGMTL-QPQPYLICAERR 462
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.97
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.97
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.97
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.96
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.96
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.96
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.95
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.95
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.94
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.94
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.94
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.94
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.94
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.93
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.93
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.92
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.92
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.92
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.91
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8e-34  Score=203.16  Aligned_cols=112  Identities=27%  Similarity=0.584  Sum_probs=99.1

Q ss_pred             CccCCCCEEeechhhhccCCCCCCCCCCCCCCCcCCCCCCccccCCccceeeccCCCCCCCchHHHHHHHHHHHHHHHHh
Q 044618            1 YHVPAGTQLFVNAWKIQRDPSVWEEPCQFQPERFLTRYKDIDVRGQNFELIPFGSGRRMCPAVSLGLQVVQLTLASLVHA   80 (121)
Q Consensus         1 ~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~~~~~~la~ll~~   80 (121)
                      |.||||+.|+++.+++|+||++|+||++|+||||++.+.+   ...+..++|||+|+|.|+|+++|.+|++++++.||++
T Consensus       359 ~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~---~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~  435 (472)
T d1tqna_         359 MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKD---NIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQN  435 (472)
T ss_dssp             EEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGG---GCCTTTSCTTCCSTTSCTTHHHHHHHHHHHHHHHHTT
T ss_pred             ceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcc---cCCCceecCCCCCCccChhHHHHHHHHHHHHHHHHHh
Confidence            5799999999999999999999999999999999986632   1246789999999999999999999999999999999


Q ss_pred             ceeeCCCCCCCCCccccceeeccCCCeEEEEEeCC
Q 044618           81 FDFTTPSDEPVDMGEAMGLAIAKATPLEVILSPRL  115 (121)
Q Consensus        81 f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~r~  115 (121)
                      |+|+++++.+.+.....+.++.|+.++.|++++|.
T Consensus       436 f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R~  470 (472)
T d1tqna_         436 FSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRD  470 (472)
T ss_dssp             EEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEETT
T ss_pred             CEEEeCCCCCCCceeccceEEeeCCCEEEEEEECC
Confidence            99999877665665555667778889999999996
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure