Citrus Sinensis ID: 044684

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-----
MPTPPPPDPVTFLEPVRPKYPHHLNPLQKLAASALDKIEDSLIGFFEKGKSLPKTVDPTVQISGNFAPVQECPVHHGLQVVGRIPDCLRGVYVRNGANPMFVPSGGHHLFDGDGMIHAVTLGHANQASYSCRYTQTSRLVQEAKYGKPVFPKPIGELHGHLGLARLGLFMARAGAGLVDGSRGMGVANAGLVYFHGSLLAMSEDDLPYRVKIKPDGDLETIGRFSFDDQLDCPMIAHPKVDPVTSDLHALSYNVVRKPYLKYFRFGGSNDGKKSRDVDVTLDQPTMIHDFAITENCVIIPDHQVVFKLSEMIRGGSPVIFDKNKTSRFGVLSKNDADESGIQWIDVPNCFCFHLWNAWEENNDDGDRNVVVIGSCMDPPDSVFNEHQDPVRSELSEIRLNLKTGESTRRVVVSGMNLEAGQVNRALLGQKTRYVYLAIADPWPKCSGIAKVDLGTGEVTKFMYGAHRFGGEPMFVPQNSKNVGSGREDEGFIMGFVRDERREESEMVIVKASSMEQVASVKLPRRVPYGFHGTFISEQELSGQVL
ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccCEEEEccccccCEEEECccccccccccccccccccccEEEEEEccccEEEEEEEEEccHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEEEEccEEEEEECcccccEEEcccccccccccccccccccccccccccCCccccccEEEEEECccccccEEEEEEECcccccEEEEEEECcccccEEEcccccccEEEECcccccccHHHHHcccccEEEccccccEEEEEEcccccccccEEEEcccCEEEEEEEEECcccccEEEEEEEEccccccccccccccccccccEEEEEEEEcccccEEEEEEEccccccccccccccccccccEEEEEEEcccccccEEEEEEcccccEEEEEccccccccccEEECcccccccccccccCEEEEEEEEccccEEEEEEEEcccccEEEEEEcccccccccccccccccccccccc
***********************LNPLQKLAASALDKIEDSLIGFFEKGKSLPKTVDPTVQISGNFAPVQECPVHHGLQVVGRIPDCLRGVYVRNGANPMFVPSGGHHLFDGDGMIHAVTLGHANQASYSCRYTQTSRLVQEAKYGKPVFPKPIGELHGHLGLARLGLFMARAGAGLVDGSRGMGVANAGLVYFHGSLLAMSEDDLPYRVKIKPDGDLETIGRFSFDDQLDCPMIAHPKVDPVTSDLHALSYNVVRKPYLKYFRFGGSNDGKKSRDVDVTLDQPTMIHDFAITENCVIIPDHQVVFKLSEMIRGGSPVIFDKNKTSRFGVLSKNDADESGIQWIDVPNCFCFHLWNAWEENNDDGDRNVVVIGSCMDPPDSVFNEHQDPVRSELSEIRLNLKTGESTRRVVVSGMNLEAGQVNRALLGQKTRYVYLAIADPWPKCSGIAKVDLGTGEVTKFMYGAHRFGGEPMFVPQNSK****GREDEGFIMGFVRDERREESEMVIVKASSMEQVASVKLPRRVPYGFHGTFISEQELSG*V*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTPPPPDPVTFLEPVRPKYPHHLNPLQKLAASALDKIEDSLIGFFEKGKSLPKTVDPTVQISGNFAPVQECPVHHGLQVVGRIPDCLRGVYVRNGANPMFVPSGGHHLFDGDGMIHAVTLGHANQASYSCRYTQTSRLVQEAKYGKPVFPKPIGELHGHLGLARLGLFMARAGAGLVDGSRGMGVANAGLVYFHGSLLAMSEDDLPYRVKIKPDGDLETIGRFSFDDQLDCPMIAHPKVDPVTSDLHALSYNVVRKPYLKYFRFGGSNDGKKSRDVDVTLDQPTMIHDFAITENCVIIPDHQVVFKLSEMIRGGSPVIFDKNKTSRFGVLSKNDADESGIQWIDVPNCFCFHLWNAWEENNDDGDRNVVVIGSCMDPPDSVFNEHQDPVRSELSEIRLNLKTGESTRRVVVSGMNLEAGQVNRALLGQKTRYVYLAIADPWPKCSGIAKVDLGTGEVTKFMYGAHRFGGEPMFVPQNSKNVGSGREDEGFIMGFVRDERREESEMVIVKASSMEQVASVKLPRRVPYGFHGTFISEQELSGQVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity. Catalyzes the first step of abscisic-acid biosynthesis from carotenoids. Contributes probably to abscisic acid synthesis for the induction of seed dormancy.probableQ9LRM7
9-cis-epoxycarotenoid dioxygenase 1, chloroplastic Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity. Catalyzes the first step of abscisic-acid biosynthesis from carotenoids. Not active on the all-trans isomers of violaxanthin and neoxanthin. Contributes probably to abscisic acid synthesis for the induction of seed dormancy.probableO24592
9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity. Catalyzes the first step of abscisic-acid biosynthesis from carotenoids, in response to water stress. Active on 9-cis-violaxanthin and 9'-cis-neoxanthin, but not on the all-trans isomers of violaxanthin and neoxanthin.probableQ9M6E8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.13.-.-Acting on single donors with incorporation of molecular oxygen.probable
1.13.11.-With incorporation of two atoms of oxygen.probable
1.13.11.519-cis-epoxycarotenoid dioxygenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NPE, chain A
Confidence level:very confident
Coverage over the Query: 23-544
View the alignment between query and template
View the model in PyMOL