Citrus Sinensis ID: 044737


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASVVEESEEEEQRVEVEEKEEEEDEIVESDIELEGDIVEADNDPPQKMGDSSAEVTDEKREAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRIEEHRRKYDRLRREREERKVERERLRRRAEAQAAYEKAKKEEQSSSSERPGGMPGGAGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGGPK
ccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHcccHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHccccc
***EKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLH******************************************************************************AAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNA********************************************************************************************************************************************************VAPIIAKMMAKF****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPxxxxxxxxxxxxxxxxxxxxxxxxxxIVESDIELEGDIVEADNDPPQKMGDSSAEVTDEKREAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRPGGMPGGAGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGGPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
FAM10 family protein At4g22670 probableQ93YR3
Hsc70-interacting protein One HIP oligomer binds the ATPase domains of at least two HSC70 molecules dependent on activation of the HSC70 ATPase by HSP40. Stabilizes the ADP state of HSC70 that has a high affinity for substrate protein. Through its own chaperone activity, it may contribute to the interaction of HSC70 with various target proteins.probableQ5ZLF0
Hsc70-interacting protein 1 One HIP oligomer binds the ATPase domains of at least two Hsc70 molecules dependent on activation of the Hsc70 ATPase by Hsp40. Stabilizes the ADP state of Hsc70 that has a high affinity for substrate protein. Through its own chaperone activity, it may contribute to the interaction of Hsc70 with various target proteins.probableC4NYP8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 118-243
View the alignment between query and template
View the model in PyMOL
Template: 2Y4T, chain A
Confidence level:very confident
Coverage over the Query: 119-274
View the alignment between query and template
View the model in PyMOL
Template: 2LLW, chain A
Confidence level:confident
Coverage over the Query: 342-394
View the alignment between query and template
View the model in PyMOL
Template: 1DX0, chain A
Confidence level:probable
Coverage over the Query: 368-382
View the alignment between query and template
View the model in PyMOL