Citrus Sinensis ID: 044737


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASVVEESEEEEQRVEVEEKEEEEDEIVESDIELEGDIVEADNDPPQKMGDSSAEVTDEKREAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRIEEHRRKYDRLRREREERKVERERLRRRAEAQAAYEKAKKEEQSSSSERPGGMPGGAGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGGPK
ccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHcccHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHEEEEcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccHHHHHHHccHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHccccc
MDAEKVKELKQFIDQcksnpsiladpslSFFRDYLESLHakvptdaykegkseprasvveeseeeEQRVEVEEKEEEEDEIVesdielegdiveadndppqkmgdssaeVTDEKREAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAAleinpdsakgyktRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRIEEHRRKYDRLRREREERKVERERLRRRAEAQAAYEKAKKeeqsssserpggmpggaggmpggfpggmpggfpggmpggfpggmpggfpggmpggfpggmpgggpgnvdfskilndpelmaafsdPEVMAALQDVMKnpanlaqhqanpkVAPIIAKMMAKFGGPK
MDAEKVKELKQFIDqcksnpsiladPSLSFFRDYLESLHAkvptdaykegkseprasvveeseeeeqrveveekeeeedeivesdielegdiveadndppqkmgdssaevTDEKREAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLkkvepnalrieehrrkydrlrrereerkvererlrRRAEAQAAyekakkeeqsssserpggMPGGAGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGGPK
MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASvveeseeeeqrveveekeeeedeivesdieleGDIVEADNDPPQKMGDSSAEVTDekreaaaeakakameaISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRIeehrrkydrlrrereerkvererlrrraeaqaayekakkeeqsssserpggmpggaggmpggfpggmpggfpggmpggfpggmpggfpggmpggfpggmpgggpgNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGGPK
*********************ILADPSLSFFRDYLESLH**************************************************************************************************IELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNA************************************************************************************************************************************************************************
***EKVKELKQFIDQCKSNPSILADPSLSFFRDYLES********************************************************************************AAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKV************************************************************************************************************************************************************VAPIIAKMMAKF****
MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPT***************************************SDIELEGDIVEADNDP****************************AISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRIEEHRRKYDRLRR***************************************MPGGAGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGGPK
MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKV***********************************************G*I*E*DNDPPQKMGDSSAEVTDEKREAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRIEEHRRKYDRLRREREERKVERERLRRRAE********************************GFPGGMPGGFPGGMPGGFPGG*P**************MPGGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFG***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPxxxxxxxxxxxxxxxxxxxxxxxxxxIVESDIELEGDIVEADNDPPQKMGDSSAEVTDEKREAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNPSAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRPGGMPGGAGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFGGPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query399 2.2.26 [Sep-21-2011]
Q93YR3441 FAM10 family protein At4g yes no 0.691 0.625 0.744 1e-105
Q5ZLF0361 Hsc70-interacting protein yes no 0.877 0.969 0.450 1e-81
Q8VWG7380 TPR repeat-containing thi no no 0.631 0.663 0.594 2e-79
Q6ES52317 TPR repeat-containing thi no no 0.458 0.577 0.706 3e-67
Q8IZP2240 Putative protein FAM10A4 yes no 0.593 0.987 0.476 2e-56
Q8NFI4369 Putative protein FAM10A5 yes no 0.596 0.644 0.473 3e-56
Q99L47371 Hsc70-interacting protein yes no 0.578 0.622 0.472 6e-56
Q5RF31369 Hsc70-interacting protein yes no 0.581 0.628 0.481 6e-55
P50502369 Hsc70-interacting protein yes no 0.581 0.628 0.481 6e-55
P50503368 Hsc70-interacting protein yes no 0.578 0.627 0.464 2e-54
>sp|Q93YR3|F10AL_ARATH FAM10 family protein At4g22670 OS=Arabidopsis thaliana GN=At4g22670 PE=1 SV=1 Back     alignment and function desciption
 Score =  381 bits (979), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 237/282 (84%), Gaps = 6/282 (2%)

Query: 1   MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGK-SEPRASVV 59
           MD+ K+ ELK FIDQCKS+PS+L  PSLSFFRDYLESL AK+PT  ++E K ++PR+ VV
Sbjct: 1   MDSTKLSELKVFIDQCKSDPSLLTTPSLSFFRDYLESLGAKIPTGVHEEDKDTKPRSFVV 60

Query: 60  EESE----EEEQRVEVEEKEEEEDEIVESDIELEGDIVEADNDPPQKMGDSSAEVTDEKR 115
           EES+    E E+     E+EEEEDEIVESD+ELEGD VE DNDPPQKMGDSS EVTDE R
Sbjct: 61  EESDDDMDETEEVKPKVEEEEEEDEIVESDVELEGDTVEPDNDPPQKMGDSSVEVTDENR 120

Query: 116 EAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNP-SAIMYATRASVYIKMKKPNAAIRDA 174
           EAA EAK KAMEA+SEG  DEAIE  T AI LNP SAIMY  RASVYIK+KKPNAAIRDA
Sbjct: 121 EAAQEAKGKAMEALSEGNFDEAIEHLTRAITLNPTSAIMYGNRASVYIKLKKPNAAIRDA 180

Query: 175 TAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRI 234
            AALEINPDSAKGYK+RGMA AMLG W EA  DLH+AS ID+DEEI+AVLKKVEPNA ++
Sbjct: 181 NAALEINPDSAKGYKSRGMARAMLGEWAEAAKDLHLASTIDYDEEISAVLKKVEPNAHKL 240

Query: 235 EEHRRKYDRLRREREERKVERERLRRRAEAQAAYEKAKKEEQ 276
           EEHRRKYDRLR+ERE++K ER+RLRRRAEAQAAY+KAKKEEQ
Sbjct: 241 EEHRRKYDRLRKEREDKKAERDRLRRRAEAQAAYDKAKKEEQ 282





Arabidopsis thaliana (taxid: 3702)
>sp|Q5ZLF0|F10A1_CHICK Hsc70-interacting protein OS=Gallus gallus GN=ST13 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWG7|TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana GN=TDX PE=1 SV=1 Back     alignment and function description
>sp|Q6ES52|TDX_ORYSJ TPR repeat-containing thioredoxin TDX OS=Oryza sativa subsp. japonica GN=Os09g0401200 PE=2 SV=1 Back     alignment and function description
>sp|Q8IZP2|ST134_HUMAN Putative protein FAM10A4 OS=Homo sapiens GN=ST13P4 PE=5 SV=1 Back     alignment and function description
>sp|Q8NFI4|F10A5_HUMAN Putative protein FAM10A5 OS=Homo sapiens GN=ST13P5 PE=5 SV=1 Back     alignment and function description
>sp|Q99L47|F10A1_MOUSE Hsc70-interacting protein OS=Mus musculus GN=St13 PE=2 SV=1 Back     alignment and function description
>sp|Q5RF31|F10A1_PONAB Hsc70-interacting protein OS=Pongo abelii GN=ST13 PE=2 SV=1 Back     alignment and function description
>sp|P50502|F10A1_HUMAN Hsc70-interacting protein OS=Homo sapiens GN=ST13 PE=1 SV=2 Back     alignment and function description
>sp|P50503|F10A1_RAT Hsc70-interacting protein OS=Rattus norvegicus GN=St13 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
224071579410 predicted protein [Populus trichocarpa] 0.959 0.934 0.708 1e-124
224125128397 predicted protein [Populus trichocarpa] 0.969 0.974 0.711 1e-121
115443603408 Os02g0100300 [Oryza sativa Japonica Grou 0.974 0.953 0.611 1e-120
296085089386 unnamed protein product [Vitis vinifera] 0.962 0.994 0.665 1e-116
116780898401 unknown [Picea sitchensis] 0.959 0.955 0.618 1e-111
218189855350 hypothetical protein OsI_05447 [Oryza sa 0.736 0.84 0.609 1e-106
166407425417 Hsp70-interacting protein 1 [Vitis labru 0.739 0.707 0.689 1e-104
18415982441 HSP70-interacting protein 1 [Arabidopsis 0.691 0.625 0.744 1e-103
297803858425 hypothetical protein ARALYDRAFT_492602 [ 0.691 0.649 0.741 1e-103
147834848374 hypothetical protein VITISV_043507 [Viti 0.696 0.743 0.702 1e-97
>gi|224071579|ref|XP_002303525.1| predicted protein [Populus trichocarpa] gi|222840957|gb|EEE78504.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 301/425 (70%), Positives = 338/425 (79%), Gaps = 42/425 (9%)

Query: 1   MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASVVE 60
           MDA K++ELKQFI+QCKSNPSILADPSLSFF DYLESL AK+P  A+K   S+ ++ VVE
Sbjct: 2   MDATKLEELKQFIEQCKSNPSILADPSLSFFHDYLESLGAKLPACAHKHDDSKSKSYVVE 61

Query: 61  ESEEEEQRVEVE----EKEEEEDEIVESDIELEGDIVEADNDPPQKMGDSSAEVTDEKRE 116
           ES+EE ++ E +     +EEEE+EI+ESD+ELEG+ VE DNDPPQKMGD S EVT+E R+
Sbjct: 62  ESDEEMEKEESQGEPEVEEEEEEEIIESDVELEGETVEPDNDPPQKMGDPSVEVTEESRD 121

Query: 117 AAAEAKAKAMEAISEGKLDEAIELSTEAIMLNP-SAIMYATRASVYIKMKKPNAAIRDAT 175
           A+ EAKAKAMEAISEGKL+EAIE  TEAI LNP SAIMYATRA+VYIKMK+PNAAIRDA 
Sbjct: 122 ASQEAKAKAMEAISEGKLEEAIEHLTEAISLNPTSAIMYATRATVYIKMKRPNAAIRDAN 181

Query: 176 AALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRIE 235
           AALEIN DSAKGYK+RGMA AMLG WE+A  DLH+ASK+D+DEEI+AVLKKVEPNA RIE
Sbjct: 182 AALEINLDSAKGYKSRGMARAMLGQWEDAAKDLHLASKLDYDEEISAVLKKVEPNAHRIE 241

Query: 236 EHRRKYDRLRREREERKVERERLRRRAEAQAAYEKAKKEEQSSSSERPGGMPG------- 288
           EHRRKY+RL +ERE+RK ERER RRRA+AQA YEKAKK+EQSSSS +PGGMP        
Sbjct: 242 EHRRKYERLHKEREDRKAERERQRRRAKAQAEYEKAKKQEQSSSSRKPGGMPSGFPGGFP 301

Query: 289 --------------GAGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMP 334
                           GGMPGG PGGMPGG PGGMPGGFPG MPGG P            
Sbjct: 302 GGMPGGMPGGMPGGMPGGMPGGMPGGMPGGMPGGMPGGFPGAMPGGMP------------ 349

Query: 335 GGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAK 394
               GNVDFSKILNDPELMAAFSDPE+MAALQDVMKNPANLA+HQ NPKVAPIIAKMM K
Sbjct: 350 ----GNVDFSKILNDPELMAAFSDPEIMAALQDVMKNPANLAKHQGNPKVAPIIAKMMGK 405

Query: 395 FGGPK 399
           F GPK
Sbjct: 406 FAGPK 410




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224125128|ref|XP_002329900.1| predicted protein [Populus trichocarpa] gi|222871137|gb|EEF08268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115443603|ref|NP_001045581.1| Os02g0100300 [Oryza sativa Japonica Group] gi|41053216|dbj|BAD08177.1| putative tetratricopeptide repeat (TPR)-containing protein [Oryza sativa Japonica Group] gi|51535306|dbj|BAD38567.1| putative tetratricopeptide repeat (TPR)-containing protein [Oryza sativa Japonica Group] gi|113535112|dbj|BAF07495.1| Os02g0100300 [Oryza sativa Japonica Group] gi|222621984|gb|EEE56116.1| hypothetical protein OsJ_04979 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|296085089|emb|CBI28504.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|116780898|gb|ABK21869.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|218189855|gb|EEC72282.1| hypothetical protein OsI_05447 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|166407425|gb|ABY87519.1| Hsp70-interacting protein 1 [Vitis labrusca] Back     alignment and taxonomy information
>gi|18415982|ref|NP_567663.1| HSP70-interacting protein 1 [Arabidopsis thaliana] gi|75331763|sp|Q93YR3.1|F10AL_ARATH RecName: Full=FAM10 family protein At4g22670 gi|16648867|gb|AAL24285.1| HSP associated protein like [Arabidopsis thaliana] gi|21593067|gb|AAM65016.1| HSP associated protein like [Arabidopsis thaliana] gi|28058906|gb|AAO29967.1| HSP associated protein like [Arabidopsis thaliana] gi|332659238|gb|AEE84638.1| HSP70-interacting protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297803858|ref|XP_002869813.1| hypothetical protein ARALYDRAFT_492602 [Arabidopsis lyrata subsp. lyrata] gi|297315649|gb|EFH46072.1| hypothetical protein ARALYDRAFT_492602 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147834848|emb|CAN68309.1| hypothetical protein VITISV_043507 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query399
TAIR|locus:2132579441 HIP1 "HSP70-interacting protei 0.363 0.328 0.698 2.6e-93
UNIPROTKB|P50502369 ST13 "Hsc70-interacting protei 0.358 0.387 0.520 1.7e-65
UNIPROTKB|A7E3S8369 ST13 "Uncharacterized protein" 0.358 0.387 0.520 4.4e-65
UNIPROTKB|Q8NFI4369 ST13P5 "Putative protein FAM10 0.358 0.387 0.506 1e-63
UNIPROTKB|Q5ZLF0361 ST13 "Hsc70-interacting protei 0.358 0.396 0.527 1.6e-63
MGI|MGI:1917606371 St13 "suppression of tumorigen 0.573 0.617 0.408 9.9e-62
RGD|621312368 St13 "suppression of tumorigen 0.573 0.622 0.408 4.2e-61
TAIR|locus:2088560380 TDX "tetraticopeptide domain-c 0.360 0.378 0.655 2.9e-58
WB|WBGene00011735422 hip-1 [Caenorhabditis elegans 0.358 0.338 0.430 9.2e-48
FB|FBgn0260484377 HIP "Hsc/Hsp70-interacting pro 0.358 0.379 0.458 1.1e-46
TAIR|locus:2132579 HIP1 "HSP70-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 498 (180.4 bits), Expect = 2.6e-93, Sum P(3) = 2.6e-93
 Identities = 102/146 (69%), Positives = 110/146 (75%)

Query:    90 GDIVEADNDPPQKMGDSSAEVTDXXXXXXXXXXXXXXXXISEGKLDEAIELSTEAIMLNP 149
             GD VE DNDPPQKMGDSS EVTD                +SEG  DEAIE  T AI LNP
Sbjct:    95 GDTVEPDNDPPQKMGDSSVEVTDENREAAQEAKGKAMEALSEGNFDEAIEHLTRAITLNP 154

Query:   150 -SAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDL 208
              SAIMY  RASVYIK+KKPNAAIRDA AALEINPDSAKGYK+RGMA AMLG W EA  DL
Sbjct:   155 TSAIMYGNRASVYIKLKKPNAAIRDANAALEINPDSAKGYKSRGMARAMLGEWAEAAKDL 214

Query:   209 HVASKIDFDEEIAAVLKKVEPNALRI 234
             H+AS ID+DEEI+AVLKKVEPNA ++
Sbjct:   215 HLASTIDYDEEISAVLKKVEPNAHKL 240


GO:0005737 "cytoplasm" evidence=ISM
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
UNIPROTKB|P50502 ST13 "Hsc70-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7E3S8 ST13 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NFI4 ST13P5 "Putative protein FAM10A5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLF0 ST13 "Hsc70-interacting protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1917606 St13 "suppression of tumorigenicity 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621312 St13 "suppression of tumorigenicity 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2088560 TDX "tetraticopeptide domain-containing thioredoxin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00011735 hip-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0260484 HIP "Hsc/Hsp70-interacting protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86DS1F10A2_DROMENo assigned EC number0.34920.82700.8753yesno
Q93YR3F10AL_ARATHNo assigned EC number0.74460.69170.6258yesno
Q5ZLF0F10A1_CHICKNo assigned EC number0.45070.87710.9695yesno
C4NYP8F10A1_DROMENo assigned EC number0.34920.82700.8753yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0018018701
hypothetical protein (411 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-16
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 9e-12
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-10
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 1e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-09
smart0072741 smart00727, STI1, Heat shock chaperonin-binding mo 1e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-06
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 3e-05
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 4e-05
PTZ00009653 PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro 4e-05
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 5e-05
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 9e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-04
pfam0702083 pfam07020, Orthopox_C10L, Orthopoxvirus C10L prote 4e-04
pfam1337173 pfam13371, TPR_9, Tetratricopeptide repeat 5e-04
pfam0717291 pfam07172, GRP, Glycine rich protein family 6e-04
pfam04959211 pfam04959, ARS2, Arsenite-resistance protein 2 6e-04
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 8e-04
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 0.001
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.001
PLN02316 1036 PLN02316, PLN02316, synthase/transferase 0.001
smart00157218 smart00157, PRP, Major prion protein 0.001
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 73.6 bits (181), Expect = 3e-16
 Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 122 KAKAMEAISEGKLDEAIELSTEAIMLNP-SAIMYATRASVYIKMKKPNAAIRDATAALEI 180
                     G  DEA+E   +A+ L+P +A  Y   A+ Y K+ K   A+ D   ALE+
Sbjct: 4   LNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALEL 63

Query: 181 NPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKID 215
           +PD+AK Y   G+A+  LG +EEA+     A ++D
Sbjct: 64  DPDNAKAYYNLGLAYYKLGKYEEALEAYEKALELD 98


Length = 100

>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|128966 smart00727, STI1, Heat shock chaperonin-binding motif Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|115660 pfam07020, Orthopox_C10L, Orthopoxvirus C10L protein Back     alignment and domain information
>gnl|CDD|205550 pfam13371, TPR_9, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|218350 pfam04959, ARS2, Arsenite-resistance protein 2 Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|215180 PLN02316, PLN02316, synthase/transferase Back     alignment and domain information
>gnl|CDD|197548 smart00157, PRP, Major prion protein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 399
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 100.0
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.93
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.92
KOG0553304 consensus TPR repeat-containing protein [General f 99.91
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.88
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.86
KOG4234271 consensus TPR repeat-containing protein [General f 99.77
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.74
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.69
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.68
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.66
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 99.64
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.62
PRK15359144 type III secretion system chaperone protein SscB; 99.61
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.54
PRK11189296 lipoprotein NlpI; Provisional 99.48
KOG0547606 consensus Translocase of outer mitochondrial membr 99.48
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.47
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.45
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.43
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.42
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.4
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.34
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.34
PRK10370198 formate-dependent nitrite reductase complex subuni 99.34
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.33
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.29
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.25
KOG0553304 consensus TPR repeat-containing protein [General f 99.25
KOG1126638 consensus DNA-binding cell division cycle control 99.24
PRK12370553 invasion protein regulator; Provisional 99.24
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.24
PRK10370198 formate-dependent nitrite reductase complex subuni 99.22
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.22
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.21
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.21
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.21
PRK15359144 type III secretion system chaperone protein SscB; 99.2
KOG4555175 consensus TPR repeat-containing protein [Function 99.19
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.19
KOG1125579 consensus TPR repeat-containing protein [General f 99.16
PRK12370553 invasion protein regulator; Provisional 99.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.14
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.14
KOG2076 895 consensus RNA polymerase III transcription factor 99.14
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.14
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.13
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.13
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.12
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.1
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.08
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.06
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.06
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.06
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.05
PRK11189296 lipoprotein NlpI; Provisional 99.05
KOG1126638 consensus DNA-binding cell division cycle control 99.03
PLN02789320 farnesyltranstransferase 99.02
PRK10803263 tol-pal system protein YbgF; Provisional 99.0
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.99
PRK15331165 chaperone protein SicA; Provisional 98.98
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.97
PLN02789320 farnesyltranstransferase 98.97
PRK11788389 tetratricopeptide repeat protein; Provisional 98.96
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.96
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.95
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.93
PRK11788389 tetratricopeptide repeat protein; Provisional 98.93
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.91
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.91
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.89
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.89
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.88
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.87
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.86
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.86
PF13512142 TPR_18: Tetratricopeptide repeat 98.86
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.82
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.81
KOG1128777 consensus Uncharacterized conserved protein, conta 98.8
PF1337173 TPR_9: Tetratricopeptide repeat 98.79
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.79
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.77
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.76
PF1337173 TPR_9: Tetratricopeptide repeat 98.76
KOG1125579 consensus TPR repeat-containing protein [General f 98.75
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.75
KOG4234271 consensus TPR repeat-containing protein [General f 98.71
KOG2003840 consensus TPR repeat-containing protein [General f 98.7
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.7
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.69
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.67
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.67
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.66
PF12688120 TPR_5: Tetratrico peptide repeat 98.65
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.64
PRK14574 822 hmsH outer membrane protein; Provisional 98.63
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.61
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.61
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.6
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.6
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.59
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.59
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.57
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.57
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.57
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.55
KOG1310758 consensus WD40 repeat protein [General function pr 98.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.54
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.53
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.53
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 98.52
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.52
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.51
KOG2003840 consensus TPR repeat-containing protein [General f 98.51
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.49
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.46
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.45
KOG2076 895 consensus RNA polymerase III transcription factor 98.44
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.44
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.43
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.42
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.4
PRK11906458 transcriptional regulator; Provisional 98.38
smart0072741 STI1 Heat shock chaperonin-binding motif. 98.38
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.38
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 98.34
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.34
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.34
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.33
PRK11906458 transcriptional regulator; Provisional 98.32
PRK14574 822 hmsH outer membrane protein; Provisional 98.31
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.3
KOG1129478 consensus TPR repeat-containing protein [General f 98.29
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.28
PRK10803263 tol-pal system protein YbgF; Provisional 98.28
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.27
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.27
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.24
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.23
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.19
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.16
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.14
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.12
COG4700251 Uncharacterized protein conserved in bacteria cont 98.11
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.1
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.08
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.07
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.07
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.98
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.98
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.98
PF1343134 TPR_17: Tetratricopeptide repeat 97.97
KOG1128777 consensus Uncharacterized conserved protein, conta 97.97
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.96
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.96
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.95
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.95
PF12688120 TPR_5: Tetratrico peptide repeat 97.89
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.88
PF1342844 TPR_14: Tetratricopeptide repeat 97.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.83
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.83
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.82
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.8
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.79
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.79
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.77
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.77
KOG1129478 consensus TPR repeat-containing protein [General f 97.75
KOG4555175 consensus TPR repeat-containing protein [Function 97.74
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.69
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.68
PRK10941269 hypothetical protein; Provisional 97.68
PF1343134 TPR_17: Tetratricopeptide repeat 97.67
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.65
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.57
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.56
PRK15331165 chaperone protein SicA; Provisional 97.56
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.55
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.54
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 97.51
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.5
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 97.47
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.46
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.44
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.43
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.39
KOG0495913 consensus HAT repeat protein [RNA processing and m 97.33
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.32
PF1342844 TPR_14: Tetratricopeptide repeat 97.3
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.27
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.26
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.25
KOG4507886 consensus Uncharacterized conserved protein, conta 97.21
PLN03218 1060 maturation of RBCL 1; Provisional 97.21
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.19
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.18
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.18
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.16
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.15
PLN03218 1060 maturation of RBCL 1; Provisional 97.15
PF13512142 TPR_18: Tetratricopeptide repeat 97.14
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.12
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.12
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.12
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.11
COG4700251 Uncharacterized protein conserved in bacteria cont 97.1
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.06
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.02
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.96
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.9
KOG1915677 consensus Cell cycle control protein (crooked neck 96.88
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 96.88
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.88
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.81
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.8
PTZ00009653 heat shock 70 kDa protein; Provisional 96.78
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.76
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.66
PRK10941269 hypothetical protein; Provisional 96.59
KOG1941518 consensus Acetylcholine receptor-associated protei 96.58
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.55
KOG1585308 consensus Protein required for fusion of vesicles 96.54
COG2912269 Uncharacterized conserved protein [Function unknow 96.54
PRK04841 903 transcriptional regulator MalT; Provisional 96.53
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.52
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.49
PRK04841 903 transcriptional regulator MalT; Provisional 96.43
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.37
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.36
PLN03077857 Protein ECB2; Provisional 96.36
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.31
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.3
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.28
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.27
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.25
KOG1586288 consensus Protein required for fusion of vesicles 96.23
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.23
PLN03077857 Protein ECB2; Provisional 96.19
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.11
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.04
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.03
KOG4507 886 consensus Uncharacterized conserved protein, conta 95.98
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.94
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.82
KOG2471 696 consensus TPR repeat-containing protein [General f 95.8
KOG1586288 consensus Protein required for fusion of vesicles 95.78
KOG0530318 consensus Protein farnesyltransferase, alpha subun 95.75
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 95.74
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.67
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.65
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.63
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.57
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.38
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.35
KOG3364149 consensus Membrane protein involved in organellar 95.32
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.32
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 95.24
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 95.11
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.03
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.0
KOG3364149 consensus Membrane protein involved in organellar 94.93
KOG2471 696 consensus TPR repeat-containing protein [General f 94.93
COG3898531 Uncharacterized membrane-bound protein [Function u 94.89
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.86
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.81
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 94.75
COG2912269 Uncharacterized conserved protein [Function unknow 94.73
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.4
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 94.35
KOG1585308 consensus Protein required for fusion of vesicles 93.88
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.64
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.6
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.53
COG3947361 Response regulator containing CheY-like receiver a 93.46
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.41
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.23
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 93.2
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.06
COG3629280 DnrI DNA-binding transcriptional activator of the 92.82
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.8
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 92.74
PRK14284 391 chaperone protein DnaJ; Provisional 92.55
KOG2047 835 consensus mRNA splicing factor [RNA processing and 92.37
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.28
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.26
PRK14295 389 chaperone protein DnaJ; Provisional 92.24
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 92.1
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.01
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 91.83
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 91.78
PHA02537230 M terminase endonuclease subunit; Provisional 91.34
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 91.17
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.94
COG3898 531 Uncharacterized membrane-bound protein [Function u 90.83
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.79
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 90.69
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 90.68
KOG1310 758 consensus WD40 repeat protein [General function pr 90.4
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 90.35
KOG2047835 consensus mRNA splicing factor [RNA processing and 90.27
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 90.21
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 90.12
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 89.97
KOG2610491 consensus Uncharacterized conserved protein [Funct 89.89
KOG2300629 consensus Uncharacterized conserved protein [Funct 89.76
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 89.57
PRK14286 372 chaperone protein DnaJ; Provisional 89.55
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 89.11
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.03
PRK14281 397 chaperone protein DnaJ; Provisional 88.96
COG4941415 Predicted RNA polymerase sigma factor containing a 88.87
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 88.79
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 88.4
COG5191435 Uncharacterized conserved protein, contains HAT (H 88.23
PRK14285 365 chaperone protein DnaJ; Provisional 88.04
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 87.82
KOG0529421 consensus Protein geranylgeranyltransferase type I 87.68
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 87.65
PF09986214 DUF2225: Uncharacterized protein conserved in bact 87.64
PRK14277 386 chaperone protein DnaJ; Provisional 87.47
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 87.43
KOG4814 872 consensus Uncharacterized conserved protein [Funct 87.15
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 87.06
PRK14298 377 chaperone protein DnaJ; Provisional 86.7
COG3629280 DnrI DNA-binding transcriptional activator of the 86.5
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 86.44
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 86.32
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 86.25
smart0072741 STI1 Heat shock chaperonin-binding motif. 86.14
COG4455273 ImpE Protein of avirulence locus involved in tempe 86.05
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 85.99
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 85.93
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.12
KOG09211282 consensus Dosage compensation complex, subunit MLE 84.85
PF0421269 MIT: MIT (microtubule interacting and transport) d 84.61
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 84.49
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 84.27
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 84.03
KOG3540615 consensus Beta amyloid precursor protein [General 84.01
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 84.01
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 84.0
COG5191435 Uncharacterized conserved protein, contains HAT (H 83.84
KOG0530318 consensus Protein farnesyltransferase, alpha subun 83.81
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 83.66
KOG0529421 consensus Protein geranylgeranyltransferase type I 83.46
PRK10767 371 chaperone protein DnaJ; Provisional 82.74
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 82.71
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 82.67
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.61
smart0074577 MIT Microtubule Interacting and Trafficking molecu 82.58
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 82.45
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 82.42
PTZ00037 421 DnaJ_C chaperone protein; Provisional 82.12
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 82.01
PRK14296 372 chaperone protein DnaJ; Provisional 81.75
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 81.45
COG4907595 Predicted membrane protein [Function unknown] 81.33
COG5091368 SGT1 Suppressor of G2 allele of skp1 and related p 81.13
PRK14287 371 chaperone protein DnaJ; Provisional 81.11
PRK14278 378 chaperone protein DnaJ; Provisional 80.86
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 80.48
KOG1118366 consensus Lysophosphatidic acid acyltransferase en 80.47
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 80.41
PRK14288 369 chaperone protein DnaJ; Provisional 80.37
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 80.35
PRK14279 392 chaperone protein DnaJ; Provisional 80.28
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 80.23
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=5.6e-68  Score=499.60  Aligned_cols=372  Identities=48%  Similarity=0.729  Sum_probs=297.4

Q ss_pred             CCHHHHHHHHHHHHHHhhCCCCCCccchhhHHHHHHHcCCCCCCCCCCCCCCCCCcCccccchHHhhhhhhhchhccchh
Q 044737            1 MDAEKVKELKQFIDQCKSNPSILADPSLSFFRDYLESLHAKVPTDAYKEGKSEPRASVVEESEEEEQRVEVEEKEEEEDE   80 (399)
Q Consensus         1 ~~~~~~~~l~~~~~~~~~~p~~l~~~~~~f~~~~~~~~g~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~e~~   80 (399)
                      |+..+|..|+.||.+|+++|++||.+++.|+|+|++|+|+++|++..+...+    +...+.+.+++..++ ++.+++.+
T Consensus         1 ~~~~~ll~l~~F~~~~k~~~~~l~~~~~~flr~~~~s~g~~vpp~~~k~~~~----e~~k~e~~~~~~~ee-~~~~~e~s   75 (377)
T KOG1308|consen    1 MSSPKLLILCAFVKMCKQDPSFLHTTEMIFLREWVESAGAKVPPAGQKAKSE----ENTKAEASISKSVEE-SLKAPEVS   75 (377)
T ss_pred             CCchhHHHhhhHHHHhccCchhhcccchhHHHHHHHhccCcCCCCCCcCccc----ccccccCCccccccc-ccccCCCC
Confidence            5778999999999999999999999999999999999999999984432211    111111222222222 45667778


Q ss_pred             hhhhhhccccc-ccCCCCCCCCCCCCCCcccCHHhHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CHHHHHHHH
Q 044737           81 IVESDIELEGD-IVEADNDPPQKMGDSSAEVTDEKREAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNP-SAIMYATRA  158 (399)
Q Consensus        81 ~~esd~e~~~~-~~e~~~~~~~~~~d~~~~~~ee~~~~a~~~k~~g~~~~~~g~~~~Ai~~y~~Ai~l~P-~a~~~~nra  158 (399)
                      +.+++++++.+ ||+++++++|+|||+.+++|++++++|...+..+..++..|.+++||++|+.||.++| ++.+|.+|+
T Consensus        76 ~~~~~~~~d~egviepd~d~pq~MGds~~e~Tee~~eqa~e~k~~A~eAln~G~~~~ai~~~t~ai~lnp~~a~l~~kr~  155 (377)
T KOG1308|consen   76 SPESDLEIDGEGVIEPDTDAPQEMGDSNAEITEEMMDQANDKKVQASEALNDGEFDTAIELFTSAIELNPPLAILYAKRA  155 (377)
T ss_pred             CCCcchhccCCCccccCCCcchhhchhhhhhhHHHHHHHHHHHHHHHHHhcCcchhhhhcccccccccCCchhhhccccc
Confidence            89999999999 9999999999999999999999999999999999999999999999999999999999 999999999


Q ss_pred             HHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCcHHHHHHHHHHhHHHHhHHHHH
Q 044737          159 SVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKIDFDEEIAAVLKKVEPNALRIEEHR  238 (399)
Q Consensus       159 ~a~~~l~~~~~Ai~d~~~Al~l~p~~~~a~~~~g~a~~~lg~~eeA~~~l~~Al~ldp~~~~~~~lk~v~~~~~k~~e~~  238 (399)
                      .++++++++..||+||+.||++||+.++.|.+|+.+++.+|+|++|.++|+.+++++++..+..+|++|.++++++.+++
T Consensus       156 sv~lkl~kp~~airD~d~A~ein~Dsa~~ykfrg~A~rllg~~e~aa~dl~~a~kld~dE~~~a~lKeV~p~a~ki~e~~  235 (377)
T KOG1308|consen  156 SVFLKLKKPNAAIRDCDFAIEINPDSAKGYKFRGYAERLLGNWEEAAHDLALACKLDYDEANSATLKEVFPNAGKIEEHR  235 (377)
T ss_pred             ceeeeccCCchhhhhhhhhhccCcccccccchhhHHHHHhhchHHHHHHHHHHHhccccHHHHHHHHHhccchhhhhhch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
Q 044737          239 RKYDRLRREREERKVERERLRRRAEAQAAYEKAKKEEQSSSSERPGGMPGGAGGMPGGFPGGMPGGFPGGMPGGFPGGM-  317 (399)
Q Consensus       239 ~~ye~l~~~~e~kk~~~er~~~~~~A~~~~~~~~k~~~~d~g~~~~~~p~g~~g~~gg~~gg~~gg~~gg~~gg~~gg~-  317 (399)
                      ++|++.+++++++.    ++++...++...+.+...........+.++             .+.|+|+|+|+|+|++.+ 
T Consensus       236 ~k~er~~~e~~~~~----r~er~r~~r~~~e~~~~e~~k~~~~~~~~~-------------~~~g~~p~~M~g~~~~~~~  298 (377)
T KOG1308|consen  236 RKYERAREEREIKE----RVERVRYAREPEEMANPEEFKRMLKNPQYR-------------QFLGGFPGGMPGSFPGDKR  298 (377)
T ss_pred             hHHHHHHHHhcccc----cccccccccchhhhcChhhhhhhhccCCCC-------------cccCCCcccCCCCCCCccc
Confidence            99999988876643    333333333333222211111111111111             122333444444444332 


Q ss_pred             -CCCCCCCCCCCCCCCCCCCCCCCcchhccCCCHHHHhhcCCHHHHHHHHHHhhChHHHHHhhcCCcHHHHHHHHHHhcC
Q 044737          318 -PGGFPGGMPGGFPGGMPGGGPGNVDFSKILNDPELMAAFSDPEVMAALQDVMKNPANLAQHQANPKVAPIIAKMMAKFG  396 (399)
Q Consensus       318 -~g~~~g~~~gg~~~~~~~~~p~~~~~~~~~~dpe~~~~~~dp~~~~~~~~~~~np~~~~~~~~~p~~~~~~~~l~~~~~  396 (399)
                       +++++|+   +++++ .+++|+...+++|++||+|+.+||||+|+.+++++++||+||++|++||+||++|+||+++|+
T Consensus       299 m~~~m~~~---~~n~~-~~~~p~~~gi~ki~~dpev~aAfqdp~v~aal~d~~~np~n~~kyq~n~kv~~~i~kl~~kf~  374 (377)
T KOG1308|consen  299 MTDGMKGF---DGNSP-VKQQPNQIGISKILSDPEVAAAFQDPEVQAALMDVSQNPANMMKYQNNPKVMDVISKLSQKFP  374 (377)
T ss_pred             cccccccC---CCCCc-cccCCCcccHhhhcCchHHHHhhcChHHHhhhhhcccChHHHHHhccChHHHHHHHHHHhhcC
Confidence             2222221   11111 233454445899999999999999999999999999999999999999999999999999999


Q ss_pred             CC
Q 044737          397 GP  398 (399)
Q Consensus       397 ~~  398 (399)
                      |+
T Consensus       375 g~  376 (377)
T KOG1308|consen  375 GM  376 (377)
T ss_pred             CC
Confidence            86



>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG3540 consensus Beta amyloid precursor protein [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG4907 Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG5091 SGT1 Suppressor of G2 allele of skp1 and related proteins [General function prediction only] Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1118 consensus Lysophosphatidic acid acyltransferase endophilin/SH3GL, involved in synaptic vesicle formation [Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 1e-07
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 2e-07
1wao_1 477 Pp5 Structure Length = 477 2e-07
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 1e-06
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 2e-06
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 3e-06
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 1e-05
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 1e-05
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-05
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 7e-05
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 1e-04
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 1e-04
2gw1_A 514 Crystal Structure Of The Yeast Tom70 Length = 514 2e-04
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query399
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-30
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-29
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-27
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 9e-27
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-26
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-25
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-07
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-24
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-21
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-18
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-21
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-17
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-20
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-20
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-17
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-09
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 4e-20
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-18
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-18
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-18
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-13
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 4e-18
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 7e-18
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-13
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 5e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-14
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-09
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-13
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 8e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-10
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-04
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 1e-12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-12
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-12
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-10
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-06
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 1e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-09
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-09
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 8e-11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-08
2kat_A115 Uncharacterized protein; NESG, structure, structur 9e-11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-10
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-10
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-10
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-09
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-09
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-08
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 3e-08
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 6e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 7e-06
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 4e-06
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 5e-06
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-06
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 9e-05
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-04
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-05
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 1e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 1e-04
1dx0_A219 Prion protein; brain, repeat; NMR {Bos taurus} SCO 4e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-04
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-04
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 2e-04
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
 Score =  117 bits (295), Expect = 1e-30
 Identities = 43/173 (24%), Positives = 72/173 (41%), Gaps = 8/173 (4%)

Query: 117 AAAEAKAKAMEAISEGKLDEAIELSTEAIMLNPS-AIMYATRASVYIKMKKPNAAIRDAT 175
           +A E K +        K  EA      AI  NP  A+ Y  RA  Y+KM++P  A+ D  
Sbjct: 3   SAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCR 62

Query: 176 AALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKID------FDEEIAAVLKKVEP 229
            ALE++  S K +   G     +  ++EA+ +L  A  +       F ++I + L+  + 
Sbjct: 63  RALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKK 122

Query: 230 NALRIEEHRRKY-DRLRREREERKVERERLRRRAEAQAAYEKAKKEEQSSSSE 281
                 E RR + +        R +  ER R   E Q  +E  + +    + +
Sbjct: 123 KRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQ 175


>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.84
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.8
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.79
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.78
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.75
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.75
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.72
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.69
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.68
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.68
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.67
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.66
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.66
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.66
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.64
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.63
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 99.63
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.63
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.62
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.61
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.61
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.61
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.6
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.58
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.58
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.58
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.58
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.57
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.57
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.57
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.56
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.55
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.55
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.55
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.54
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.53
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.52
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.52
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.51
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.48
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.47
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 99.47
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.46
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.44
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.44
3k9i_A117 BH0479 protein; putative protein binding protein, 99.44
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.44
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.43
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.43
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.42
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.41
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.41
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.41
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.41
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.41
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.39
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.39
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.38
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.38
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.38
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.38
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.38
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.38
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.37
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.37
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.36
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.36
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.35
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.35
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.35
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.35
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.34
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.34
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.34
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.34
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.33
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.33
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.32
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.32
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.32
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.32
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.32
3u4t_A272 TPR repeat-containing protein; structural genomics 99.31
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.29
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.29
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.29
3u4t_A272 TPR repeat-containing protein; structural genomics 99.29
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.28
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.28
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 99.27
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.27
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.27
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.26
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.25
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.25
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.24
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.24
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.23
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.22
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.22
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.22
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.22
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.21
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.21
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.21
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.21
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.19
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.18
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.16
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.14
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.14
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.13
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.1
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.1
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.1
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.08
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.08
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.06
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.06
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.05
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.05
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.03
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.03
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.03
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.03
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.03
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.02
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.02
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.01
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.01
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.01
3k9i_A117 BH0479 protein; putative protein binding protein, 98.99
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.99
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.98
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.97
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.97
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.96
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.95
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.95
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.95
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.93
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.93
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.92
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.92
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.91
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.9
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.89
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.89
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.89
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.89
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.89
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.88
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.87
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.87
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.86
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.85
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.85
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.84
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.84
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.83
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.82
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.8
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.79
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.79
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.77
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.76
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.72
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.72
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.71
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.68
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.68
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.68
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.67
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.66
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.66
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.61
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.59
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.51
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.42
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.41
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.38
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.34
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.3
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.3
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.27
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.22
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.21
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.18
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.1
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.03
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.01
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.98
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.96
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.92
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.9
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.84
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.72
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.69
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.65
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.64
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.63
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.62
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.52
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.47
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.43
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.34
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.32
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 97.31
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.29
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.14
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.14
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.53
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.32
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.24
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 96.07
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 95.74
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.69
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 95.5
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.35
2lnm_A62 Protein TIC 40, chloroplastic; translocon, import, 94.72
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.6
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 93.89
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.8
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 92.7
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 92.25
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 92.22
2llw_A71 Heat shock protein STI1; DP domain, alpha helix, c 91.97
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 91.75
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 91.4
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 91.23
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 89.06
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 87.8
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 87.74
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 86.84
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 85.6
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 85.02
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 84.89
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 84.87
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 84.83
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 84.72
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 84.51
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 83.66
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 83.64
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 83.34
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 81.52
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 81.44
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 81.15
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 80.63
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.84  E-value=6.3e-20  Score=153.71  Aligned_cols=105  Identities=26%  Similarity=0.408  Sum_probs=102.4

Q ss_pred             HHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHH
Q 044737          115 REAAAEAKAKAMEAISEGKLDEAIELSTEAIMLNP-SAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGM  193 (399)
Q Consensus       115 ~~~a~~~k~~g~~~~~~g~~~~Ai~~y~~Ai~l~P-~a~~~~nra~a~~~l~~~~~Ai~d~~~Al~l~p~~~~a~~~~g~  193 (399)
                      .+.++.++++|+.+++.|+|++|+.+|++||+++| ++.+|.++|.||+++++|++|+.+|++||+++|+++.+|+++|.
T Consensus        10 P~~a~~~~~~G~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~lg~   89 (126)
T 4gco_A           10 PELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKFIKGYIRKAA   89 (126)
T ss_dssp             HHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHhhHHHhhccHHHHHHHHHHHHHhhhhhhHHHHHHHH
Confidence            46788999999999999999999999999999999 99999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCHHHHHHHHHHHHhhCCcHH
Q 044737          194 AHAMLGHWEEAVHDLHVASKIDFDEE  219 (399)
Q Consensus       194 a~~~lg~~eeA~~~l~~Al~ldp~~~  219 (399)
                      +|..+|+|++|+.+|+++++++|++.
T Consensus        90 ~~~~~~~~~~A~~~~~~al~l~P~~~  115 (126)
T 4gco_A           90 CLVAMREWSKAQRAYEDALQVDPSNE  115 (126)
T ss_dssp             HHHHTTCHHHHHHHHHHHHHHCTTCH
T ss_pred             HHHHCCCHHHHHHHHHHHHHHCcCCH
Confidence            99999999999999999999999984



>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2lnm_A Protein TIC 40, chloroplastic; translocon, import, TIC40-NP, protein transport; NMR {Arabidopsis thaliana} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2llw_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 399
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 5e-14
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-09
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-07
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 3e-07
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.004
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 9e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 4e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 4e-05
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-05
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 5e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 7e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.004
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 2e-04
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 6e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.002
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 68.1 bits (165), Expect = 5e-14
 Identities = 43/173 (24%), Positives = 71/173 (41%), Gaps = 8/173 (4%)

Query: 117 AAAEAKAKAMEAISEGKLDEAIELSTEAIMLNP-SAIMYATRASVYIKMKKPNAAIRDAT 175
           +A E K +        K  EA      AI  NP  A+ Y  RA  Y+KM++P  A+ D  
Sbjct: 3   SAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCR 62

Query: 176 AALEINPDSAKGYKTRGMAHAMLGHWEEAVHDLHVASKID------FDEEIAAVLKKVEP 229
            ALE++  S K +   G     +  ++EA+ +L  A  +       F ++I + L+  + 
Sbjct: 63  RALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKK 122

Query: 230 NALRIEEHRRKYDRLRRERE-ERKVERERLRRRAEAQAAYEKAKKEEQSSSSE 281
                 E RR +          R +  ER R   E Q  +E  + +    + +
Sbjct: 123 KRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQ 175


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query399
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.82
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.81
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.81
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.8
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.78
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.78
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.63
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.57
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.56
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.53
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.51
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.47
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.47
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.43
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.43
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.37
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.37
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.36
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.33
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.32
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.27
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.23
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.21
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.2
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.19
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.18
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.11
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.1
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.06
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.89
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.82
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.79
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.77
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.73
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.67
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.66
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.66
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.44
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.43
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.33
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.33
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.32
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.27
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.21
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.04
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.82
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.54
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.28
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.75
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 90.74
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 85.17
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 83.78
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 81.2
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 81.14
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 80.65
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Hop
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=5e-20  Score=150.71  Aligned_cols=111  Identities=28%  Similarity=0.475  Sum_probs=103.9

Q ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHH
Q 044737          117 AAAEAKAKAMEAISEGKLDEAIELSTEAIMLNP-SAIMYATRASVYIKMKKPNAAIRDATAALEINPDSAKGYKTRGMAH  195 (399)
Q Consensus       117 ~a~~~k~~g~~~~~~g~~~~Ai~~y~~Ai~l~P-~a~~~~nra~a~~~l~~~~~Ai~d~~~Al~l~p~~~~a~~~~g~a~  195 (399)
                      ++..++.+|+.+++.|+|++||.+|+++|.++| ++.+|.++|.||+++++|.+|+.+|+++|+++|+++.+|+++|.++
T Consensus         2 ~~~~l~~~g~~~~~~g~~~eAi~~~~~al~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~g~~~   81 (117)
T d1elwa_           2 QVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAAL   81 (117)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCcchhhhhcccccccccccccccchhhhhHHHhccchhhHHHHHHHHH
Confidence            567899999999999999999999999999999 9999999999999999999999999999999999999999999999


Q ss_pred             HhcCCHHHHHHHHHHHHhhCCcHH-HHHHHHHH
Q 044737          196 AMLGHWEEAVHDLHVASKIDFDEE-IAAVLKKV  227 (399)
Q Consensus       196 ~~lg~~eeA~~~l~~Al~ldp~~~-~~~~lk~v  227 (399)
                      ..+|+|++|+.+|+++++++|++. +...+..+
T Consensus        82 ~~~~~~~~A~~~~~~a~~~~p~~~~~~~~l~~l  114 (117)
T d1elwa_          82 EFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNM  114 (117)
T ss_dssp             HHTTCHHHHHHHHHHHHTTCTTCHHHHHHHHHH
T ss_pred             HHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHH
Confidence            999999999999999999999984 34444443



>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure