Citrus Sinensis ID: 044740
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| 224069376 | 331 | predicted protein [Populus trichocarpa] | 0.992 | 0.398 | 0.818 | 8e-63 | |
| 225626263 | 331 | peroxidase [Populus trichocarpa] | 0.992 | 0.398 | 0.818 | 9e-63 | |
| 255557048 | 221 | Peroxidase 21 precursor, putative [Ricin | 0.992 | 0.597 | 0.825 | 2e-61 | |
| 312283385 | 328 | unnamed protein product [Thellungiella h | 0.992 | 0.402 | 0.795 | 4e-61 | |
| 388502634 | 325 | unknown [Medicago truncatula] | 0.992 | 0.406 | 0.795 | 5e-61 | |
| 253762014 | 266 | peroxidase 21, partial [Brassica rapa] | 0.992 | 0.496 | 0.787 | 5e-60 | |
| 15228090 | 327 | peroxidase [Arabidopsis thaliana] gi|254 | 0.992 | 0.403 | 0.780 | 8e-60 | |
| 21593054 | 327 | putative peroxidase ATP2a [Arabidopsis t | 0.992 | 0.403 | 0.780 | 8e-60 | |
| 186506069 | 296 | peroxidase [Arabidopsis thaliana] gi|330 | 0.992 | 0.445 | 0.780 | 9e-60 | |
| 16649127 | 227 | putative peroxidase ATP2a [Arabidopsis t | 0.992 | 0.581 | 0.780 | 2e-59 |
| >gi|224069376|ref|XP_002326343.1| predicted protein [Populus trichocarpa] gi|222833536|gb|EEE72013.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 244 bits (623), Expect = 8e-63, Method: Compositional matrix adjust.
Identities = 108/132 (81%), Positives = 123/132 (93%)
Query: 1 AHSVGRVHCANLVHRLYPTVDPTLNPVYAEYLKGRCPTPDPDPDAVVYARNDRETPMILD 60
+HSVGRVHC NLVHR+YPTVDPT++P YAEYLKGRCPTPDPDP AV+YARNDRETPMILD
Sbjct: 198 SHSVGRVHCVNLVHRIYPTVDPTMDPDYAEYLKGRCPTPDPDPQAVLYARNDRETPMILD 257
Query: 61 NNYYKNIINHKGLLIVDQQLASDPRTTPFVQKMAADNSYFHEQFSRAIALLSENNPLTGD 120
N YYKN++ HKGLL+VDQQL SDP T+P+V+KMAADN YFH+QFSRA+ LLSENNPLTG+
Sbjct: 258 NYYYKNLLGHKGLLMVDQQLTSDPLTSPYVEKMAADNGYFHDQFSRAVVLLSENNPLTGN 317
Query: 121 QGEVRKDCRYVN 132
QGE+RKDCRYVN
Sbjct: 318 QGEIRKDCRYVN 329
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225626263|gb|ACN97181.1| peroxidase [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255557048|ref|XP_002519557.1| Peroxidase 21 precursor, putative [Ricinus communis] gi|223541420|gb|EEF42971.1| Peroxidase 21 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|312283385|dbj|BAJ34558.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|388502634|gb|AFK39383.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|253762014|gb|ACT35471.1| peroxidase 21, partial [Brassica rapa] | Back alignment and taxonomy information |
|---|
| >gi|15228090|ref|NP_181250.1| peroxidase [Arabidopsis thaliana] gi|25453196|sp|Q42580.1|PER21_ARATH RecName: Full=Peroxidase 21; Short=Atperox P21; AltName: Full=ATP2a/ATP2b; AltName: Full=PRXR5; Flags: Precursor gi|1403138|emb|CAA66863.1| peroxidase ATP2a [Arabidopsis thaliana] gi|4371288|gb|AAD18146.1| putative peroxidase ATP2a [Arabidopsis thaliana] gi|330254260|gb|AEC09354.1| peroxidase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21593054|gb|AAM65003.1| putative peroxidase ATP2a [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|186506069|ref|NP_001118461.1| peroxidase [Arabidopsis thaliana] gi|330254261|gb|AEC09355.1| peroxidase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|16649127|gb|AAL24415.1| putative peroxidase ATP2a [Arabidopsis thaliana] gi|20148519|gb|AAM10150.1| putative peroxidase ATP2a [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| TAIR|locus:2061794 | 327 | AT2G37130 [Arabidopsis thalian | 0.992 | 0.403 | 0.780 | 1.4e-57 | |
| TAIR|locus:2141637 | 330 | PRXR1 [Arabidopsis thaliana (t | 0.992 | 0.4 | 0.621 | 5e-44 | |
| TAIR|locus:2013001 | 358 | AT1G71695 [Arabidopsis thalian | 0.924 | 0.343 | 0.385 | 3e-21 | |
| TAIR|locus:2173757 | 328 | AT5G40150 [Arabidopsis thalian | 0.977 | 0.396 | 0.409 | 9.2e-20 | |
| TAIR|locus:2174693 | 330 | AT5G14130 [Arabidopsis thalian | 0.954 | 0.384 | 0.391 | 1.4e-18 | |
| TAIR|locus:2097273 | 352 | AT3G32980 [Arabidopsis thalian | 0.962 | 0.363 | 0.366 | 4.4e-18 | |
| TAIR|locus:2057180 | 349 | AT2G38380 [Arabidopsis thalian | 0.962 | 0.366 | 0.384 | 7.1e-18 | |
| TAIR|locus:2101298 | 354 | PRXCA "peroxidase CA" [Arabido | 0.969 | 0.364 | 0.364 | 1.3e-17 | |
| TAIR|locus:2086047 | 339 | AT3G17070 [Arabidopsis thalian | 0.977 | 0.383 | 0.350 | 3e-17 | |
| TAIR|locus:2138273 | 346 | Prx37 "peroxidase 37" [Arabido | 0.962 | 0.369 | 0.366 | 3.4e-17 |
| TAIR|locus:2061794 AT2G37130 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 592 (213.5 bits), Expect = 1.4e-57, P = 1.4e-57
Identities = 103/132 (78%), Positives = 119/132 (90%)
Query: 1 AHSVGRVHCANLVHRLYPTVDPTLNPVYAEYLKGRCPTPDPDPDAVVYARNDRETPMILD 60
AHSVGRVHC NLVHRLYPT+DPTL+P YA YLK RCP+P PDP+AV+Y+RNDRETPM++D
Sbjct: 196 AHSVGRVHCVNLVHRLYPTIDPTLDPSYALYLKKRCPSPTPDPNAVLYSRNDRETPMVVD 255
Query: 61 NNYYKNIINHKGLLIVDQQLASDPRTTPFVQKMAADNSYFHEQFSRAIALLSENNPLTGD 120
N YYKNI+ HKGLL++D +LA+DPRT PFV KMAADN+YFHEQFSR + LLSE NPLTGD
Sbjct: 256 NMYYKNIMAHKGLLVIDDELATDPRTAPFVAKMAADNNYFHEQFSRGVRLLSETNPLTGD 315
Query: 121 QGEVRKDCRYVN 132
QGE+RKDCRYVN
Sbjct: 316 QGEIRKDCRYVN 327
|
|
| TAIR|locus:2141637 PRXR1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013001 AT1G71695 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173757 AT5G40150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174693 AT5G14130 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2097273 AT3G32980 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2057180 AT2G38380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101298 PRXCA "peroxidase CA" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086047 AT3G17070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2138273 Prx37 "peroxidase 37" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| PO2 | hypothetical protein (331 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| cd00693 | 298 | cd00693, secretory_peroxidase, Horseradish peroxid | 3e-56 | |
| PLN03030 | 324 | PLN03030, PLN03030, cationic peroxidase; Provision | 1e-13 | |
| PLN02879 | 251 | PLN02879, PLN02879, L-ascorbate peroxidase | 6e-07 | |
| pfam00141 | 180 | pfam00141, peroxidase, Peroxidase | 8e-07 | |
| cd00314 | 255 | cd00314, plant_peroxidase_like, Heme-dependent per | 1e-06 | |
| cd00691 | 253 | cd00691, ascorbate_peroxidase, Ascorbate peroxidas | 5e-06 | |
| PLN02364 | 250 | PLN02364, PLN02364, L-ascorbate peroxidase 1 | 1e-05 |
| >gnl|CDD|173827 cd00693, secretory_peroxidase, Horseradish peroxidase and related secretory plant peroxidases | Back alignment and domain information |
|---|
Score = 176 bits (449), Expect = 3e-56
Identities = 59/136 (43%), Positives = 78/136 (57%), Gaps = 8/136 (5%)
Query: 1 AHSVGRVHCANLVHRLYPT-----VDPTLNPVYAEYLKGRCPTPDPDPDAVVYARNDRET 55
AH++GR HC++ RLY DPTL+P YA L+ +CP D D +V D T
Sbjct: 166 AHTIGRAHCSSFSDRLYNFSGTGDPDPTLDPAYAAQLRKKCPAGG-DDDTLVP--LDPGT 222
Query: 56 PMILDNNYYKNIINHKGLLIVDQQLASDPRTTPFVQKMAADNSYFHEQFSRAIALLSENN 115
P DN+YYKN++ +GLL DQ L SDPRT V + AA+ F F+ A+ +
Sbjct: 223 PNTFDNSYYKNLLAGRGLLTSDQALLSDPRTRAIVNRYAANQDAFFRDFAAAMVKMGNIG 282
Query: 116 PLTGDQGEVRKDCRYV 131
LTG QGE+RK+CR V
Sbjct: 283 VLTGSQGEIRKNCRVV 298
|
Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. Length = 298 |
| >gnl|CDD|215545 PLN03030, PLN03030, cationic peroxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178467 PLN02879, PLN02879, L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215745 pfam00141, peroxidase, Peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|173823 cd00314, plant_peroxidase_like, Heme-dependent peroxidases similar to plant peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|173825 cd00691, ascorbate_peroxidase, Ascorbate peroxidases and cytochrome C peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|166005 PLN02364, PLN02364, L-ascorbate peroxidase 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| PLN03030 | 324 | cationic peroxidase; Provisional | 100.0 | |
| cd00693 | 298 | secretory_peroxidase Horseradish peroxidase and re | 100.0 | |
| cd00649 | 409 | catalase_peroxidase_1 N-terminal catalytic domain | 99.96 | |
| PLN02608 | 289 | L-ascorbate peroxidase | 99.94 | |
| TIGR00198 | 716 | cat_per_HPI catalase/peroxidase HPI. Note that the | 99.93 | |
| PRK15061 | 726 | catalase/hydroperoxidase HPI(I); Provisional | 99.92 | |
| cd00692 | 328 | ligninase Ligninase and other manganese-dependent | 99.9 | |
| PF00141 | 230 | peroxidase: Peroxidase; InterPro: IPR002016 Peroxi | 99.9 | |
| cd00691 | 253 | ascorbate_peroxidase Ascorbate peroxidases and cyt | 99.89 | |
| PLN02879 | 251 | L-ascorbate peroxidase | 99.89 | |
| PLN02364 | 250 | L-ascorbate peroxidase 1 | 99.89 | |
| cd00314 | 255 | plant_peroxidase_like Heme-dependent peroxidases s | 99.84 | |
| cd08200 | 297 | catalase_peroxidase_2 C-terminal non-catalytic dom | 99.18 | |
| COG0376 | 730 | KatG Catalase (peroxidase I) [Inorganic ion transp | 99.03 | |
| TIGR00198 | 716 | cat_per_HPI catalase/peroxidase HPI. Note that the | 98.85 | |
| PRK15061 | 726 | catalase/hydroperoxidase HPI(I); Provisional | 98.79 | |
| cd08201 | 264 | plant_peroxidase_like_1 Uncharacterized family of | 98.71 | |
| COG0376 | 730 | KatG Catalase (peroxidase I) [Inorganic ion transp | 84.1 |
| >PLN03030 cationic peroxidase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-49 Score=321.07 Aligned_cols=129 Identities=29% Similarity=0.555 Sum_probs=120.4
Q ss_pred CccccccCCCCcccccCC------CCCCCCCHHHHHHHHccCCCCCCCCCcccccccCCCCCcccchHHhhhhccccccc
Q 044740 1 AHSVGRVHCANLVHRLYP------TVDPTLNPVYAEYLKGRCPTPDPDPDAVVYARNDRETPMILDNNYYKNIINHKGLL 74 (133)
Q Consensus 1 aHTiG~ahC~~f~~Rl~~------~~dp~~~~~~~~~L~~~Cp~~~~~~~~~~l~~~D~~tp~~FDn~Yy~nl~~~~gll 74 (133)
|||||++||.+|.+|||+ .+||+||+.|+..|++.||..+...+.++| |+.||.+|||+||+||++++|+|
T Consensus 186 AHTiG~ahC~~f~~Rlynf~~~~~~~Dp~~d~~~~~~L~~~Cp~~~~~~~~~~l---D~~Tp~~FDn~Yy~nll~~rGlL 262 (324)
T PLN03030 186 GHTIGTTACQFFRYRLYNFTTTGNGADPSIDASFVPQLQALCPQNGDGSRRIAL---DTGSSNRFDASFFSNLKNGRGIL 262 (324)
T ss_pred ccccceeeeeccccccccccCCCCCCCCchhHHHHHHHhccCCCCCCCCccccC---CCCCCcccccHHHHHHHhcCCCc
Confidence 799999999999999994 369999999999999999964333456889 99999999999999999999999
Q ss_pred cccccccCCCCcHHHHHHhhhCh----HHHHHHHHHHHHHhhcCCCCCCCCCcccccccccC
Q 044740 75 IVDQQLASDPRTTPFVQKMAADN----SYFHEQFSRAIALLSENNPLTGDQGEVRKDCRYVN 132 (133)
Q Consensus 75 ~sD~~L~~d~~t~~~V~~~a~~~----~~F~~~Fa~AmvKm~~i~v~tg~~GeiR~~C~~vN 132 (133)
+|||+|+.|++|+++|++||.|+ +.|+++|++||+|||+|+|+||.+||||++|+++|
T Consensus 263 ~SDq~L~~d~~T~~~V~~~A~~~~~~~~~F~~~Fa~AmvKMg~i~VlTG~~GEIRk~C~~vN 324 (324)
T PLN03030 263 ESDQKLWTDASTRTFVQRFLGVRGLAGLNFNVEFGRSMVKMSNIGVKTGTNGEIRKVCSAIN 324 (324)
T ss_pred CCchHhhcCccHHHHHHHHhcccccchhhhHHHHHHHHHHHccCCCCCCCCCceeccccccC
Confidence 99999999999999999999875 59999999999999999999999999999999998
|
|
| >cd00693 secretory_peroxidase Horseradish peroxidase and related secretory plant peroxidases | Back alignment and domain information |
|---|
| >cd00649 catalase_peroxidase_1 N-terminal catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >PLN02608 L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >TIGR00198 cat_per_HPI catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >PRK15061 catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >cd00692 ligninase Ligninase and other manganese-dependent fungal peroxidases | Back alignment and domain information |
|---|
| >PF00141 peroxidase: Peroxidase; InterPro: IPR002016 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions | Back alignment and domain information |
|---|
| >cd00691 ascorbate_peroxidase Ascorbate peroxidases and cytochrome C peroxidases | Back alignment and domain information |
|---|
| >PLN02879 L-ascorbate peroxidase | Back alignment and domain information |
|---|
| >PLN02364 L-ascorbate peroxidase 1 | Back alignment and domain information |
|---|
| >cd00314 plant_peroxidase_like Heme-dependent peroxidases similar to plant peroxidases | Back alignment and domain information |
|---|
| >cd08200 catalase_peroxidase_2 C-terminal non-catalytic domain of catalase-peroxidases | Back alignment and domain information |
|---|
| >COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00198 cat_per_HPI catalase/peroxidase HPI | Back alignment and domain information |
|---|
| >PRK15061 catalase/hydroperoxidase HPI(I); Provisional | Back alignment and domain information |
|---|
| >cd08201 plant_peroxidase_like_1 Uncharacterized family of plant peroxidase-like proteins | Back alignment and domain information |
|---|
| >COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 133 | ||||
| 1bgp_A | 309 | Crystal Structure Of Barley Grain Peroxidase 1 Leng | 1e-22 | ||
| 1gx2_A | 309 | Recombinant Horseradish Peroxidase Phe209ser Comple | 5e-19 | ||
| 3hdl_A | 304 | Crystal Structure Of Highly Glycosylated Peroxidase | 5e-19 | ||
| 1gw2_A | 308 | Recombinant Horseradish Peroxidase C1a Thr171ser In | 6e-19 | ||
| 3atj_A | 309 | Heme Ligand Mutant Of Recombinant Horseradish Perox | 1e-18 | ||
| 1w4w_A | 323 | Ferric Horseradish Peroxidase C1a In Complex With F | 1e-18 | ||
| 4atj_A | 309 | Distal Heme Pocket Mutant (H42e) Of Recombinant Hor | 1e-18 | ||
| 1kzm_A | 308 | Distal Heme Pocket Mutant (r38s/h42e) Of Recombinan | 1e-18 | ||
| 1gwu_A | 309 | Recombinant Horseradish Peroxidase C1a Ala140gly Le | 1e-18 | ||
| 2atj_A | 308 | Recombinant Horseradish Peroxidase Complex With Ben | 1e-18 | ||
| 1gwo_A | 309 | Recombinant Horseradish Peroxidase C1a Ala170gln Le | 1e-18 | ||
| 1atj_A | 306 | Recombinant Horseradish Peroxidase C1a Length = 306 | 1e-18 | ||
| 6atj_A | 308 | Recombinant Horseradish Peroxidase C Complex With F | 1e-18 | ||
| 2ylj_A | 306 | Horse Radish Peroxidase, Mutant S167y Length = 306 | 1e-18 | ||
| 1pa2_A | 306 | Arabidopsis Thaliana Peroxidase A2 Length = 306 | 8e-17 | ||
| 1sch_A | 294 | Peanut Peroxidase Length = 294 | 2e-16 | ||
| 1fhf_A | 304 | The Structure Of Soybean Peroxidase Length = 304 | 8e-15 | ||
| 4a5g_A | 308 | Raphanus Sativus Anionic Peroxidase. Length = 308 | 6e-13 | ||
| 1qgj_A | 300 | Arabidopsis Thaliana Peroxidase N Length = 300 | 4e-12 | ||
| 2y6a_A | 249 | Ascorbate Peroxidase R38a Mutant Length = 249 | 2e-04 | ||
| 3zcy_A | 249 | Ascorbate Peroxidase W41a-h42y Mutant Length = 249 | 2e-04 | ||
| 3zcg_A | 261 | Ascorbate Peroxidase W41a-h42c Mutant Length = 261 | 2e-04 | ||
| 2xif_A | 249 | The Structure Of Ascorbate Peroxidase Compound Ii L | 2e-04 | ||
| 2vcs_A | 261 | Structure Of Isoniazid (Inh) Bound To Cytosolic Soy | 2e-04 | ||
| 2cl4_X | 261 | Ascorbate Peroxidase R172a Mutant Length = 261 | 2e-04 | ||
| 1oaf_A | 261 | Ascobate Peroxidase From Soybean Cytosol In Complex | 2e-04 | ||
| 2y6b_A | 249 | Ascorbate Peroxidase R38k Mutant Length = 249 | 2e-04 | ||
| 2ggn_X | 261 | Conformational Mobility In The Active Site Of A Hem | 2e-04 | ||
| 2vcf_X | 264 | Structure Of Isoniazid (Inh) Bound To Cytosolic Soy | 2e-04 | ||
| 3zch_A | 261 | Ascorbate Peroxidase W41a-h42m Mutant Length = 261 | 2e-04 |
| >pdb|1BGP|A Chain A, Crystal Structure Of Barley Grain Peroxidase 1 Length = 309 | Back alignment and structure |
|
| >pdb|1GX2|A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|3HDL|A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree Length = 304 | Back alignment and structure |
| >pdb|1GW2|A Chain A, Recombinant Horseradish Peroxidase C1a Thr171ser In Complex With Ferulic Acid Length = 308 | Back alignment and structure |
| >pdb|3ATJ|A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|1W4W|A Chain A, Ferric Horseradish Peroxidase C1a In Complex With Formate Length = 323 | Back alignment and structure |
| >pdb|4ATJ|A Chain A, Distal Heme Pocket Mutant (H42e) Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 | Back alignment and structure |
| >pdb|1KZM|A Chain A, Distal Heme Pocket Mutant (r38s/h42e) Of Recombinant Horseradish Peroxidase C (hrp C) Length = 308 | Back alignment and structure |
| >pdb|1GWU|A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly Length = 309 | Back alignment and structure |
| >pdb|2ATJ|A Chain A, Recombinant Horseradish Peroxidase Complex With Benzhydroxamic Acid Length = 308 | Back alignment and structure |
| >pdb|1GWO|A Chain A, Recombinant Horseradish Peroxidase C1a Ala170gln Length = 309 | Back alignment and structure |
| >pdb|1ATJ|A Chain A, Recombinant Horseradish Peroxidase C1a Length = 306 | Back alignment and structure |
| >pdb|6ATJ|A Chain A, Recombinant Horseradish Peroxidase C Complex With Ferulic Acid Length = 308 | Back alignment and structure |
| >pdb|2YLJ|A Chain A, Horse Radish Peroxidase, Mutant S167y Length = 306 | Back alignment and structure |
| >pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2 Length = 306 | Back alignment and structure |
| >pdb|1SCH|A Chain A, Peanut Peroxidase Length = 294 | Back alignment and structure |
| >pdb|1FHF|A Chain A, The Structure Of Soybean Peroxidase Length = 304 | Back alignment and structure |
| >pdb|4A5G|A Chain A, Raphanus Sativus Anionic Peroxidase. Length = 308 | Back alignment and structure |
| >pdb|1QGJ|A Chain A, Arabidopsis Thaliana Peroxidase N Length = 300 | Back alignment and structure |
| >pdb|2Y6A|A Chain A, Ascorbate Peroxidase R38a Mutant Length = 249 | Back alignment and structure |
| >pdb|3ZCY|A Chain A, Ascorbate Peroxidase W41a-h42y Mutant Length = 249 | Back alignment and structure |
| >pdb|3ZCG|A Chain A, Ascorbate Peroxidase W41a-h42c Mutant Length = 261 | Back alignment and structure |
| >pdb|2XIF|A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii Length = 249 | Back alignment and structure |
| >pdb|2VCS|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Mutant H42a Length = 261 | Back alignment and structure |
| >pdb|2CL4|X Chain X, Ascorbate Peroxidase R172a Mutant Length = 261 | Back alignment and structure |
| >pdb|1OAF|A Chain A, Ascobate Peroxidase From Soybean Cytosol In Complex With Ascorbate Length = 261 | Back alignment and structure |
| >pdb|2Y6B|A Chain A, Ascorbate Peroxidase R38k Mutant Length = 249 | Back alignment and structure |
| >pdb|2GGN|X Chain X, Conformational Mobility In The Active Site Of A Heme Peroxidase Length = 261 | Back alignment and structure |
| >pdb|2VCF|X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Length = 264 | Back alignment and structure |
| >pdb|3ZCH|A Chain A, Ascorbate Peroxidase W41a-h42m Mutant Length = 261 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| 1bgp_A | 309 | Barley grain peroxidase; chromoprotein, oxidoreduc | 2e-50 | |
| 3hdl_A | 304 | Royal PALM TREE peroxidase; glycosylated, oxidored | 2e-48 | |
| 1sch_A | 294 | PNP, peanut peroxidase, major cationic isozyme; ca | 1e-47 | |
| 1fhf_A | 304 | SEED coat peroxidase; oxidoreductase; HET: HEM; 2. | 2e-45 | |
| 1gwu_A | 309 | Peroxidase C1A; oxidoreductase, glycoprotein, heme | 1e-44 | |
| 1pa2_A | 306 | Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 | 1e-44 | |
| 1qgj_A | 300 | Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A | 6e-42 | |
| 3m5q_A | 357 | Manganese peroxidase 1; heme, Mn(II)-binding site, | 3e-22 | |
| 1iyn_A | 295 | Chloroplastic ascorbate peroxidase; hydrogen perox | 5e-22 | |
| 3fmu_A | 331 | VersatIle peroxidase VPL2; class II (fungal) perox | 2e-17 | |
| 2vcn_A | 261 | Ascorbate peroxidase; INH, APX, isoniazid, oxidore | 2e-13 | |
| 2e39_A | 344 | Peroxidase; heme protein, coordination geometry of | 4e-13 | |
| 1llp_A | 343 | LIP4.15, lignin peroxidase; heme protein, glyco pr | 4e-13 | |
| 3q3u_A | 338 | Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A | 1e-12 | |
| 3riv_A | 271 | Ascorbate peroxidase; alpha helical bundle, heme p | 3e-05 |
| >1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Length = 309 | Back alignment and structure |
|---|
Score = 161 bits (411), Expect = 2e-50
Identities = 48/132 (36%), Positives = 71/132 (53%), Gaps = 4/132 (3%)
Query: 1 AHSVGRVHCANLVHRLYPTVDPTLNPVYAEYLKGRCPTPDPDPDAVVYARNDRETPMILD 60
H++G HC++ RL+P DPT++P + LK CP D V D TP + D
Sbjct: 178 GHTIGLAHCSSFEDRLFPRPDPTISPTFLSRLKRTCPAKGTDRRTV----LDVRTPNVFD 233
Query: 61 NNYYKNIINHKGLLIVDQQLASDPRTTPFVQKMAADNSYFHEQFSRAIALLSENNPLTGD 120
N YY +++N +GL + DQ L ++ T P V++ A F EQF +I + + T D
Sbjct: 234 NKYYIDLVNREGLFVSDQDLFTNAITRPIVERFAQSQQDFFEQFGVSIGKMGQMRVRTSD 293
Query: 121 QGEVRKDCRYVN 132
QGEVR++C N
Sbjct: 294 QGEVRRNCSVRN 305
|
| >3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} Length = 304 | Back alignment and structure |
|---|
| >1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Length = 294 | Back alignment and structure |
|---|
| >1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Length = 304 | Back alignment and structure |
|---|
| >1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Length = 309 | Back alignment and structure |
|---|
| >1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Length = 306 | Back alignment and structure |
|---|
| >1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Length = 300 | Back alignment and structure |
|---|
| >3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Length = 357 | Back alignment and structure |
|---|
| >1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Length = 295 | Back alignment and structure |
|---|
| >3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* Length = 331 | Back alignment and structure |
|---|
| >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Length = 261 | Back alignment and structure |
|---|
| >2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Length = 344 | Back alignment and structure |
|---|
| >1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Length = 343 | Back alignment and structure |
|---|
| >3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} Length = 338 | Back alignment and structure |
|---|
| >3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* Length = 271 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| 3hdl_A | 304 | Royal PALM TREE peroxidase; glycosylated, oxidored | 100.0 | |
| 1fhf_A | 304 | SEED coat peroxidase; oxidoreductase; HET: HEM; 2. | 100.0 | |
| 1pa2_A | 306 | Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 | 100.0 | |
| 1sch_A | 294 | PNP, peanut peroxidase, major cationic isozyme; ca | 100.0 | |
| 1bgp_A | 309 | Barley grain peroxidase; chromoprotein, oxidoreduc | 100.0 | |
| 1gwu_A | 309 | Peroxidase C1A; oxidoreductase, glycoprotein, heme | 100.0 | |
| 1qgj_A | 300 | Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A | 100.0 | |
| 1iyn_A | 295 | Chloroplastic ascorbate peroxidase; hydrogen perox | 99.97 | |
| 1llp_A | 343 | LIP4.15, lignin peroxidase; heme protein, glyco pr | 99.95 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 99.95 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 99.95 | |
| 2e39_A | 344 | Peroxidase; heme protein, coordination geometry of | 99.95 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 99.95 | |
| 3q3u_A | 338 | Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A | 99.95 | |
| 3fmu_A | 331 | VersatIle peroxidase VPL2; class II (fungal) perox | 99.95 | |
| 3m5q_A | 357 | Manganese peroxidase 1; heme, Mn(II)-binding site, | 99.94 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 99.94 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 99.94 | |
| 3vli_A | 737 | Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 | 99.93 | |
| 3riv_A | 271 | Ascorbate peroxidase; alpha helical bundle, heme p | 99.9 | |
| 2vcn_A | 261 | Ascorbate peroxidase; INH, APX, isoniazid, oxidore | 99.9 | |
| 3e2o_A | 294 | CCP, cytochrome C peroxidase; cytochrome C peroxid | 99.86 | |
| 1u2k_A | 309 | Peroxidase/catalase HPI; KATG, catalase-peroxidase | 99.81 | |
| 1ub2_A | 720 | Catalase-peroxidase; KATG, cyanobacteria, oxidored | 99.75 | |
| 1itk_A | 731 | Catalase-peroxidase; heme protein, oxidoreductase; | 99.73 | |
| 3vli_A | 737 | Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 | 99.72 | |
| 3ut2_A | 764 | Catalase-peroxidase 2; KATG, fungal, heme enzyme, | 99.72 | |
| 3n3r_A | 748 | Catalase-peroxidase; E198A variant, tuberclosis, i | 99.7 | |
| 2cca_A | 740 | Peroxidase/catalase T; oxidoreductase, catalase-pe | 99.68 | |
| 3rrw_A | 268 | Thylakoid lumenal 29 kDa protein, chloroplastic; c | 98.95 |
| >3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} SCOP: a.93.1.0 | Back alignment and structure |
|---|
Probab=100.00 E-value=8.1e-51 Score=326.69 Aligned_cols=130 Identities=38% Similarity=0.671 Sum_probs=124.1
Q ss_pred CccccccCCCCcccccCC-----CCCCCCCHHHHHHHHccCCCCCC--CCCcccccccCCCCCcccchHHhhhhcccccc
Q 044740 1 AHSVGRVHCANLVHRLYP-----TVDPTLNPVYAEYLKGRCPTPDP--DPDAVVYARNDRETPMILDNNYYKNIINHKGL 73 (133)
Q Consensus 1 aHTiG~ahC~~f~~Rl~~-----~~dp~~~~~~~~~L~~~Cp~~~~--~~~~~~l~~~D~~tp~~FDn~Yy~nl~~~~gl 73 (133)
|||||++||.+|.+|||+ .+||+||+.|++.|+..||.+++ +.+.++| |+.||.+|||+||+||+.++||
T Consensus 168 aHTiG~ahC~~f~~Rly~f~~~~~~DP~ld~~~a~~L~~~Cp~~~~~~~~~~~~l---D~~TP~~FDN~Yy~nL~~~~gl 244 (304)
T 3hdl_A 168 AHSIGVAHCSSFTNRLYNFNSGSGIDPTLSPSYAALLRNTCPANSTRFTPITVSL---DIITPSVLDNMYYTGVQLTLGL 244 (304)
T ss_dssp GGGSSEEEGGGTGGGTSSCSSSSSSCTTSCHHHHHHHHHHSCTTCCTTSCCEEES---CSSSTTSCSTHHHHHHHTTCCC
T ss_pred cccccccccchhhhhhcccCCCCCCCCcccHHHHHHHhccCCCCCCCCCccccCC---CCCCcccccHHHHHHHHhCcCC
Confidence 799999999999999995 47999999999999999998766 6678899 9999999999999999999999
Q ss_pred ccccccccCCCCcHHHHHHhhhChHHHHHHHHHHHHHhhcCCCCCCCCCcccccccccCC
Q 044740 74 LIVDQQLASDPRTTPFVQKMAADNSYFHEQFSRAIALLSENNPLTGDQGEVRKDCRYVNI 133 (133)
Q Consensus 74 l~sD~~L~~d~~t~~~V~~~a~~~~~F~~~Fa~AmvKm~~i~v~tg~~GeiR~~C~~vN~ 133 (133)
|+|||+|+.|++|+.+|+.||.|++.|+++|++||+|||+|+|+||.+||||++|++||.
T Consensus 245 L~SDq~L~~d~~t~~~V~~yA~~~~~F~~~Fa~AmvKmg~igv~tg~~GeIR~~C~~~N~ 304 (304)
T 3hdl_A 245 LTSDQALVTEANLSAAVKANAMNLTAWASKFAQAMVKMGQIEVLTGTQGEIRTNCSVVNS 304 (304)
T ss_dssp SHHHHGGGSSHHHHHHHHHHHHCHHHHHHHHHHHHHHHTTTTCCCTTSSBCCSBTTBCC-
T ss_pred CCCCHHHhcCccHHHHHHHhccCHHHHHHHHHHHHHHHHhcCCCCCCCCeeeCCccccCC
Confidence 999999999999999999999999999999999999999999999999999999999994
|
| >1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* | Back alignment and structure |
|---|
| >1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... | Back alignment and structure |
|---|
| >1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 | Back alignment and structure |
|---|
| >1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} SCOP: a.93.1.0 | Back alignment and structure |
|---|
| >3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* 4fcn_A* 4g05_A* 4fcs_A* 4fef_A* 4fdq_A* | Back alignment and structure |
|---|
| >3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
| >3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* | Back alignment and structure |
|---|
| >3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* 4ged_A* | Back alignment and structure |
|---|
| >2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... | Back alignment and structure |
|---|
| >3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} SCOP: a.93.1.1 PDB: 4a71_A* 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 4a6z_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* ... | Back alignment and structure |
|---|
| >1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A | Back alignment and structure |
|---|
| >1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 | Back alignment and structure |
|---|
| >3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* | Back alignment and structure |
|---|
| >3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} | Back alignment and structure |
|---|
| >3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* | Back alignment and structure |
|---|
| >2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* | Back alignment and structure |
|---|
| >3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 133 | ||||
| d1bgpa_ | 309 | a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vu | 5e-40 | |
| d1pa2a_ | 306 | a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A | 9e-36 | |
| d1fhfa_ | 304 | a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine m | 1e-35 | |
| d1scha_ | 294 | a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hy | 5e-35 | |
| d1gwua_ | 307 | a.93.1.1 (A:) Plant peroxidase {Horseradish (Armor | 5e-32 | |
| d1qgja_ | 300 | a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A | 3e-31 | |
| d1yyda1 | 357 | a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) { | 2e-20 | |
| d2e39a1 | 336 | a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) { | 4e-19 | |
| d1llpa_ | 343 | a.93.1.1 (A:) Fungal peroxidase (ligninase) {White | 4e-18 | |
| d2euta1 | 291 | a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {B | 3e-12 | |
| d1oafa_ | 250 | a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glyci | 8e-10 | |
| d1iyna_ | 275 | a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco | 9e-10 |
| >d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Length = 309 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme-dependent peroxidases superfamily: Heme-dependent peroxidases family: CCP-like domain: Plant peroxidase species: Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]
Score = 133 bits (336), Expect = 5e-40
Identities = 48/132 (36%), Positives = 71/132 (53%), Gaps = 4/132 (3%)
Query: 1 AHSVGRVHCANLVHRLYPTVDPTLNPVYAEYLKGRCPTPDPDPDAVVYARNDRETPMILD 60
H++G HC++ RL+P DPT++P + LK CP D V D TP + D
Sbjct: 178 GHTIGLAHCSSFEDRLFPRPDPTISPTFLSRLKRTCPAKGTDRRTV----LDVRTPNVFD 233
Query: 61 NNYYKNIINHKGLLIVDQQLASDPRTTPFVQKMAADNSYFHEQFSRAIALLSENNPLTGD 120
N YY +++N +GL + DQ L ++ T P V++ A F EQF +I + + T D
Sbjct: 234 NKYYIDLVNREGLFVSDQDLFTNAITRPIVERFAQSQQDFFEQFGVSIGKMGQMRVRTSD 293
Query: 121 QGEVRKDCRYVN 132
QGEVR++C N
Sbjct: 294 QGEVRRNCSVRN 305
|
| >d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Length = 306 | Back information, alignment and structure |
|---|
| >d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 304 | Back information, alignment and structure |
|---|
| >d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 294 | Back information, alignment and structure |
|---|
| >d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Length = 307 | Back information, alignment and structure |
|---|
| >d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Length = 300 | Back information, alignment and structure |
|---|
| >d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 357 | Back information, alignment and structure |
|---|
| >d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Length = 336 | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 343 | Back information, alignment and structure |
|---|
| >d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 291 | Back information, alignment and structure |
|---|
| >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 250 | Back information, alignment and structure |
|---|
| >d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 275 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| d1fhfa_ | 304 | Plant peroxidase {Soybean (Glycine max) [TaxId: 38 | 100.0 | |
| d1bgpa_ | 309 | Plant peroxidase {Barley (Hordeum vulgare), peroxi | 100.0 | |
| d1pa2a_ | 306 | Plant peroxidase {Mouse-ear cress (Arabidopsis tha | 100.0 | |
| d1qgja_ | 300 | Plant peroxidase {Mouse-ear cress (Arabidopsis tha | 100.0 | |
| d1gwua_ | 307 | Plant peroxidase {Horseradish (Armoracia rusticana | 100.0 | |
| d1scha_ | 294 | Plant peroxidase {Peanut (Arachis hypogaea) [TaxId | 100.0 | |
| d1iyna_ | 275 | Ascorbate peroxidase {Common tobacco (Nicotiana ta | 99.94 | |
| d1yyda1 | 357 | Fungal peroxidase (ligninase) {Basidomycetos fungu | 99.93 | |
| d2e39a1 | 336 | Fungal peroxidase (ligninase) {Arthromyces ramosus | 99.9 | |
| d1llpa_ | 343 | Fungal peroxidase (ligninase) {White rot basidiomy | 99.88 | |
| d1oafa_ | 250 | Ascorbate peroxidase {Soybean (Glycine max) [TaxId | 99.88 | |
| d2euta1 | 291 | Cytochrome c peroxidase, CCP {Baker's yeast (Sacch | 99.87 | |
| d1mwva1 | 406 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 99.32 | |
| d2ccaa1 | 410 | Catalase-peroxidase KatG {Mycobacterium tuberculos | 99.25 | |
| d1ub2a2 | 294 | Catalase-peroxidase KatG {Synechococcus sp. pcc 79 | 99.2 | |
| d1mwva2 | 308 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 99.16 | |
| d1u2ka_ | 292 | Catalase-peroxidase KatG {Burkholderia pseudomalle | 99.16 | |
| d1ub2a1 | 406 | Catalase-peroxidase KatG {Synechococcus sp. pcc 79 | 99.12 | |
| d1itka2 | 308 | Catalase-peroxidase KatG {Archaeon Haloarcula mari | 99.1 | |
| d1itka1 | 406 | Catalase-peroxidase KatG {Archaeon Haloarcula mari | 99.06 | |
| d2ccaa2 | 285 | Catalase-peroxidase KatG {Mycobacterium tuberculos | 96.73 | |
| d1llpa_ | 343 | Fungal peroxidase (ligninase) {White rot basidiomy | 85.65 |
| >d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Heme-dependent peroxidases superfamily: Heme-dependent peroxidases family: CCP-like domain: Plant peroxidase species: Soybean (Glycine max) [TaxId: 3847]
Probab=100.00 E-value=1.3e-46 Score=300.56 Aligned_cols=130 Identities=38% Similarity=0.714 Sum_probs=124.0
Q ss_pred CccccccCCCCcccccCC-----CCCCCCCHHHHHHHHccCCCCCCCCCcccccccCCCCCcccchHHhhhhcccccccc
Q 044740 1 AHSVGRVHCANLVHRLYP-----TVDPTLNPVYAEYLKGRCPTPDPDPDAVVYARNDRETPMILDNNYYKNIINHKGLLI 75 (133)
Q Consensus 1 aHTiG~ahC~~f~~Rl~~-----~~dp~~~~~~~~~L~~~Cp~~~~~~~~~~l~~~D~~tp~~FDn~Yy~nl~~~~gll~ 75 (133)
|||||++||.+|..|+|+ .+||+|++.|+..|+..||.++...+.+.+ |+.||.+|||+||+++++++|+|+
T Consensus 168 aHTiG~ahc~~~~~rl~~~~~~~~~d~~~~~~~~~~L~~~c~~~~~~~~~~~~---d~~tp~~fDn~Yy~~l~~~~glL~ 244 (304)
T d1fhfa_ 168 GHTFGRARCSTFINRLYNFSNTGNPDPTLNTTYLEVLRARCPQNATGDNLTNL---DLSTPDQFDNRYYSNLLQLNGLLQ 244 (304)
T ss_dssp GGGSCEEEGGGTGGGTSCGGGSSSCCTTSCHHHHHHHHHHSCSSCSSCCEEES---CSSSTTSCSTHHHHHHHTTCCSSH
T ss_pred hhhhcccccccccccccCCCCCCCCCcccCHHHHHHHHHhcCCCCCCCccccc---CCCCCCccccHHHHHHhhcCcccH
Confidence 799999999999999993 589999999999999999988777778889 999999999999999999999999
Q ss_pred ccccccCCC--CcHHHHHHhhhChHHHHHHHHHHHHHhhcCCCCCCCCCcccccccccCC
Q 044740 76 VDQQLASDP--RTTPFVQKMAADNSYFHEQFSRAIALLSENNPLTGDQGEVRKDCRYVNI 133 (133)
Q Consensus 76 sD~~L~~d~--~t~~~V~~~a~~~~~F~~~Fa~AmvKm~~i~v~tg~~GeiR~~C~~vN~ 133 (133)
|||+|+.|| +|+++|+.||.|++.|+++|++||+||++|+|+||.+||||++|++||.
T Consensus 245 SD~~L~~dp~~~t~~~V~~yA~d~~~F~~~F~~Am~Km~~lgv~tg~~GeiR~~C~~~N~ 304 (304)
T d1fhfa_ 245 SDQELFSTPGADTIPIVNSFSSNQNTFFSNFRVSMIKMGNIGVLTGDEGEIRLQCNFVNG 304 (304)
T ss_dssp HHHTTTSSTTCSSHHHHHHHHHCHHHHHHHHHHHHHHHTTTTCCCTTSSBCCSBTTBCCC
T ss_pred hhHHHHhCCCchHHHHHHHHhhCHHHHHHHHHHHHHHHhcCCCCCCCCCcccCcccCcCC
Confidence 999999996 6999999999999999999999999999999999999999999999995
|
| >d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} | Back information, alignment and structure |
|---|
| >d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|