Citrus Sinensis ID: 044764

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MQQPEHEAGEASRDEISTHEMNKGISILDLILRTIAAAGTFGSAIAMATTNETLTVFPQFTQVRAEYDDHPSFKFFVIANSIVCGYLAISVPLSIFHIIRTAAKKSRILLLVFDLVMLTLVTAGASSATAIVYLAHKGNTSANWFAFCQLFDSFCERISGSLIGSFAAAVTLMLVIVTSAVALSRS
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccCECcccEEEEEEECccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
**********************KGISILDLILRTIAAAGTFGSAIAMATTNETLTVFPQFTQVRAEYDDHPSFKFFVIANSIVCGYLAISVPLSIFHIIRTAAKKSRILLLVFDLVMLTLVTAGASSATAIVYLAHKGNTSANWFAFCQLFDSFCERISGSLIGSFAAAVTLMLVIVTSAVALSR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQPEHEAGEASRDEISTHEMNKGISILDLILRTIAAAGTFGSAIAMATTNETLTVFPQFTQVRAEYDDHPSFKFFVIANSIVCGYLAISVPLSIFHIIRTAAKKSRILLLVFDLVMLTLVTAGASSATAIVYLAHKGNTSANWFAFCQLFDSFCERISGSLIGSFAAAVTLMLVIVTSAVALSRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CASP-like protein Bradi1g45110 probableP0DI36
Casparian strip membrane protein VIT_14s0108g01050 Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.probableA7PMY7
Casparian strip membrane protein Os04g0460400 Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.probableQ7XUV7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted