Citrus Sinensis ID: 044772


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MTSTTASALSSSTTTTTTATKFIKCVTVRDGAVGKTCLLISYTGNTFPTDYVPTVFDNFSANVMVDGRTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISRPSYENISKKKWVPELRHYAPSVPIVLVGTKLDLRKDRQFHLDYPGAYTISTEQ
cccccccccccccccccccccEEEEEEEccccccEEEEEEEccccccccccccccccccEEEEECccCEEEEEEECcccccccccccccccccccEEEEEEEcccccccccccccccHHHHHHccccccEEEEEEcccccccccccccccccccccccc
********************KFIKCVTVRDGAVGKTCLLISYTGNTFPTDYVPTVFDNFSANVMVDGRTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISRPSYENISKKKWVPELRHYAPSVPIVLVGTKLDLRKDRQFHLDYPGAYTI****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSTTASALSSSTTTTTTATKFIKCVTVRDGAVGKTCLLISYTGNTFPTDYVPTVFDNFSANVMVDGRTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISRPSYENISKKKWVPELRHYAPSVPIVLVGTKLDLRKDRQFHLDYPGAYTISTEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related C3 botulinum toxin substrate 2 Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Augments the production of reactive oxygen species (ROS) by NADPH oxidase.probableQ05144
Rac-like GTP-binding protein 5 Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.probableQ6EP31
Rac-like GTP-binding protein ARAC5 Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.probableQ38937

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BWD, chain D
Confidence level:very confident
Coverage over the Query: 21-48,59-145
View the alignment between query and template
View the model in PyMOL
Template: 2GF9, chain A
Confidence level:very confident
Coverage over the Query: 14-153
View the alignment between query and template
View the model in PyMOL