Citrus Sinensis ID: 044785

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MPFRLTTKLVVLLLVLLRASAAAAHAQAKPGCPSRCGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITIDGRMNVMQFVAKECYRKGNSVDSYSPTFSLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVVDKSQFHFSSNYLAWEGTPEKFPLVLDWEITTKETCEEAKICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTKDGRGCIPNQNTALKVALGM
cccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccccccccccccEEEcccccccccccccccccEEEEEEEEccEEEEEEEEEEEEEEccccccccccccccccEEEEccccEEEEEcccccEEEEcccccccEEcccccccccccccccccccccccEEccccccccEEEEEEEEcccccccccccccEEEEEcccccccccccccccccccccccEEccccccccccHHHHHHcccccccccccccccccccEEEEcccccccccccccccEEcccccccccccccccccEEEEEccEEEEccccccccccccccccccccccEEEEEEcc
ccHHHHHHHHHHHHHHHHHHcccccccccccccccccccEccccccccccccccccEEEEEccccccccccEEccccEEEEEEEcccEEEEEccccHHcEcccccccccccccccccEEEcccccEEEEEEcccEEEEEcccccccEEEEEEEEcccccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEcccEEEcHHHcccccccccccEEEEEEEcccccHHHcccccccEcccccEEcccccccEEEEccccccccccccccccccHHcccccccccccccEEEcccccEEEcccccccccccccccccccccccEEEEEEEc
MPFRLTTKLVVLLLVLLRASAAAAHaqakpgcpsrcgdveipypfgtrpgcflnkYFVITcnkthynppkpflrksniEVVNITIDGRMNVMQFVAKECYrkgnsvdsysptfslskftvsntenrfvviGCDSYAYVRGYLgenryragcmsmcdsfdfvtngscvgtgccqieiprgLKELEVEAFsfnnhtnvspfnpctyasvvdksqfhfssnylawegtpekfplvldwEITTKETCEEAkicglnaschkpkdntttssgyhckcnegyegnpylsdgcqdvnecedpslnnctrthicdnipgsytcrcrkgfhgdgtkdgrgcipnqnTALKVALGM
MPFRLTTKLVVLLLVLLRASAAAAHaqakpgcpsrcGDVEIPYPFGTRPGCFLNKYFVITCNKTHynppkpflrksNIEVVNITIDGRMNVMQFVAKECYRKGNSVDSYSPTFSLSKftvsntenrfvviGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVVDKSQFHFSSNYLawegtpekfPLVLDWEITTKETCEEAKicglnaschkpkdnTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHgdgtkdgrgcipnqntalkvalgm
MPFRLTTKlvvlllvllrasaaaahaqaKPGCPSRCGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITIDGRMNVMQFVAKECYRKGNSVDSYSPTFSLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVVDKSQFHFSSNYLAWEGTPEKFPLVLDWEITTKETCEEAKICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTKDGRGCIPNQNTALKVALGM
***RLTTKLVVLLLVLLRASAAAAHAQAKPGCPSRCGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITIDGRMNVMQFVAKECYRKGNSVDSYSPTFSLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVVDKSQFHFSSNYLAWEGTPEKFPLVLDWEITTKETCEEAKICGLNASCHK******TSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTKDGRGCI*************
*****TTKLVVLLLVLLR*****************CGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITIDGRMNVMQFVAKECYRKGNSVDSYSPTFSLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVVDKSQFHFSSNYLAWEGTPEKFPLVLDWEITTKETCEEAKICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTKDGRGCIPNQNTALKVALGM
MPFRLTTKLVVLLLVLLRAS************PSRCGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITIDGRMNVMQFVAKECYRKGNSVDSYSPTFSLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVVDKSQFHFSSNYLAWEGTPEKFPLVLDWEITTKETCEEAKICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTKDGRGCIPNQNTALKVALGM
MPFRLTTKLVVLLLVLLRASAAAAHAQAKPGCPSRCGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITIDGRMNVMQFVAKECYRKGNSVDSYSPTFSLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVVDKSQFHFSSNYLAWEGTPEKFPLVLDWEITTKETCEEAKICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTKDGRGCIPNQNTALKVALGM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFRLTTKLVVLLLVLLRASAAAAHAQAKPGCPSRCGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITIDGRMNVMQFVAKECYRKGNSVDSYSPTFSLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVVDKSQFHFSSNYLAWEGTPEKFPLVLDWEITTKETCEEAKICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTKDGRGCIPNQNTALKVALGM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query346 2.2.26 [Sep-21-2011]
Q9LMP1 732 Wall-associated receptor yes no 0.867 0.409 0.400 1e-57
Q9LMN7 733 Wall-associated receptor no no 0.858 0.405 0.375 3e-48
Q9LMN8 741 Wall-associated receptor no no 0.884 0.412 0.347 1e-44
Q39191 735 Wall-associated receptor no no 0.895 0.421 0.329 2e-43
Q9LMN6 738 Wall-associated receptor no no 0.895 0.420 0.330 8e-42
Q9SA25 720 Wall-associated receptor no no 0.823 0.395 0.291 1e-25
Q8RY17 751 Wall-associated receptor no no 0.869 0.400 0.297 3e-20
Q7X8C5 748 Wall-associated receptor no no 0.852 0.394 0.289 6e-20
Q8GXQ3 642 Wall-associated receptor no no 0.832 0.448 0.282 3e-18
Q9LN59 788 Putative wall-associated no no 0.780 0.342 0.274 1e-17
>sp|Q9LMP1|WAK2_ARATH Wall-associated receptor kinase 2 OS=Arabidopsis thaliana GN=WAK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  223 bits (569), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 187/322 (58%), Gaps = 22/322 (6%)

Query: 10  VVLLLVLLRASAAAAHAQAKPGCPSRCGDVEIPYPFGTRPGCFL--NKYFVITCNKTHYN 67
           + ++ V   A       Q +  C +RCG+V + YPFGT PGC+   ++ F +TCN+    
Sbjct: 7   LFVVAVFYLAYTQLVKGQPRKECQTRCGNVAVEYPFGTSPGCYYPGDESFNLTCNEQE-- 64

Query: 68  PPKPFLRKSNIEVVNITIDGRMNVMQFVAKECY-RKGNSVDSYSPTFSLSKFTVSNTENR 126
             K F    N+ V+N+++ G++ V    ++ CY  +G   D  +   +L  FT+S   NR
Sbjct: 65  --KLFF--GNMPVINMSLSGQLRVRLVRSRVCYDSQGKQTDYIAQRTTLGNFTLSEL-NR 119

Query: 127 FVVIGCDSYAYVRGYLGENRYRAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVE 186
           F V+GC+SYA++R   G  +Y  GC+S+CDS     NGSC G GCCQI +PRG   + V+
Sbjct: 120 FTVVGCNSYAFLRTS-GVEKYSTGCISICDSAT-TKNGSCSGEGCCQIPVPRGYSFVRVK 177

Query: 187 AFSFNNHTNVSPFNPCTYASVVDKSQFHFSS-NYLAWEGTPEKFPLVLDWEITTKETCEE 245
             SF+NH  V  FNPCTYA +V+   F F +   L        FP+VLDW I  K TC++
Sbjct: 178 PHSFHNHPTVHLFNPCTYAFLVEDGMFDFHALEDLNNLRNVTTFPVVLDWSIGDK-TCKQ 236

Query: 246 AK---ICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTR 302
            +   +CG N++C     ++T  +GY+CKC EG+EGNPYL +GCQD+NEC   S +NC+ 
Sbjct: 237 VEYRGVCGGNSTCF----DSTGGTGYNCKCLEGFEGNPYLPNGCQDINEC-ISSRHNCSE 291

Query: 303 THICDNIPGSYTCRCRKGFHGD 324
              C+N  GS+ C C  G+  D
Sbjct: 292 HSTCENTKGSFNCNCPSGYRKD 313
Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. Binding to pectin may have significance in the control of cell expansion, morphogenesis and development.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 5 OS=Arabidopsis thaliana GN=WAK5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 3 OS=Arabidopsis thaliana GN=WAK3 PE=2 SV=2 Back     alignment and function description
>sp|Q39191|WAK1_ARATH Wall-associated receptor kinase 1 OS=Arabidopsis thaliana GN=WAK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 4 OS=Arabidopsis thaliana GN=WAK4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 8 OS=Arabidopsis thaliana GN=WAKL8 PE=2 SV=1 Back     alignment and function description
>sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS=Arabidopsis thaliana GN=WAKL22 PE=2 SV=1 Back     alignment and function description
>sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8GXQ3|WAKLF_ARATH Wall-associated receptor kinase-like 6 OS=Arabidopsis thaliana GN=WAKL6 PE=2 SV=2 Back     alignment and function description
>sp|Q9LN59|WAKLK_ARATH Putative wall-associated receptor kinase-like 11 OS=Arabidopsis thaliana GN=WAKL11 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
255558508 1433 ATP binding protein, putative [Ricinus c 0.867 0.209 0.517 3e-86
225459705 742 PREDICTED: wall-associated receptor kina 0.953 0.444 0.495 2e-84
359492353 820 PREDICTED: wall-associated receptor kina 0.959 0.404 0.494 3e-83
302141744 1170 unnamed protein product [Vitis vinifera] 0.913 0.270 0.474 2e-79
147814876 744 hypothetical protein VITISV_027752 [Viti 0.910 0.423 0.439 2e-77
359493501 1049 PREDICTED: wall-associated receptor kina 0.924 0.305 0.431 2e-76
359492347 722 PREDICTED: wall-associated receptor kina 0.875 0.419 0.474 4e-76
147789104 841 hypothetical protein VITISV_018565 [Viti 0.971 0.399 0.421 5e-76
359493507 713 PREDICTED: wall-associated receptor kina 0.843 0.409 0.464 1e-74
297734352 574 unnamed protein product [Vitis vinifera] 0.898 0.541 0.445 2e-73
>gi|255558508|ref|XP_002520279.1| ATP binding protein, putative [Ricinus communis] gi|223540498|gb|EEF42065.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  325 bits (832), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 166/321 (51%), Positives = 220/321 (68%), Gaps = 21/321 (6%)

Query: 32   CPSRCGDVEIPYPFGTRPGCFLNKYFVITCNK--THYNPPKPFLRKSNIEVVNITIDGRM 89
            CP RCG+V IPYPFG   GC+L+  F+ITCN   T  + P P+LRKSNI+V NI++DGR+
Sbjct: 740  CPDRCGNVSIPYPFGIE-GCYLSPEFLITCNDSLTANSTPVPYLRKSNIKVTNISLDGRL 798

Query: 90   NVMQFVAKECYRK-GNSVDSYSPTF-SLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRY 147
             ++Q  A++CY K G     +   F +LSKFT+S + N+F VIGCDSYAY+ G+     Y
Sbjct: 799  EIVQVAARDCYNKSGIRQPGFRRRFLTLSKFTISKSHNKFTVIGCDSYAYLDGFRYGKFY 858

Query: 148  RAGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASV 207
            R+GCMS+C   D V   SC G+GCCQIEIP GL      A+SF NHTN+S FNPCTYA +
Sbjct: 859  RSGCMSLCADPDLVDGKSCSGSGCCQIEIPDGLYHANATAYSFKNHTNISSFNPCTYAFI 918

Query: 208  VDKSQFHFSSNYLAWEGTPEKFPLVLDWEI--TTKETCEEAKICGLNASCHKPKDNTTTS 265
            V+ S+F+FS  YL    T ++FP+VLDW +  T K  C++      +A+ ++P +N    
Sbjct: 919  VEDSRFNFSFEYLENIPTDKEFPMVLDWAVNNTLKHACKD------HANSYQPDNN---- 968

Query: 266  SGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDG 325
            SGY CKC EGY+GNPYL  GC+DVNEC++ + N CT    C N+ GSYTC C KG+HGDG
Sbjct: 969  SGYLCKCQEGYQGNPYL--GCEDVNECKNENQNKCTDR--CTNLDGSYTCSCPKGYHGDG 1024

Query: 326  TKDGRGCIPNQNTALKVALGM 346
             KDG+GCIP+Q + +K+ LG+
Sbjct: 1025 RKDGQGCIPDQLSLIKIILGV 1045

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225459705|ref|XP_002284700.1| PREDICTED: wall-associated receptor kinase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492353|ref|XP_002284691.2| PREDICTED: wall-associated receptor kinase 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302141744|emb|CBI18947.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147814876|emb|CAN61365.1| hypothetical protein VITISV_027752 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493501|ref|XP_002263378.2| PREDICTED: wall-associated receptor kinase 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492347|ref|XP_003634400.1| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789104|emb|CAN71420.1| hypothetical protein VITISV_018565 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493507|ref|XP_002263295.2| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734352|emb|CBI15599.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
TAIR|locus:2014912 732 WAK2 "wall-associated kinase 2 0.803 0.379 0.42 5.5e-61
TAIR|locus:2014962 733 WAK5 "wall associated kinase 5 0.791 0.373 0.393 1.5e-51
TAIR|locus:2014902 735 WAK1 "cell wall-associated kin 0.817 0.385 0.352 2.9e-47
TAIR|locus:2014952 738 WAK4 "wall associated kinase 4 0.843 0.395 0.356 5.2e-47
TAIR|locus:2014897 741 WAK3 "wall associated kinase 3 0.797 0.372 0.359 9.1e-47
TAIR|locus:2032875 720 AT1G16260 [Arabidopsis thalian 0.765 0.368 0.313 3.7e-28
TAIR|locus:2019893 751 RFO1 "RESISTANCE TO FUSARIUM O 0.789 0.363 0.311 1.6e-25
TAIR|locus:2200562 748 WAKL2 "wall associated kinase- 0.789 0.364 0.297 6.9e-25
TAIR|locus:2016377 788 AT1G19390 [Arabidopsis thalian 0.447 0.196 0.308 3.1e-21
TAIR|locus:2126316 786 AT4G31100 [Arabidopsis thalian 0.471 0.207 0.287 2.2e-18
TAIR|locus:2014912 WAK2 "wall-associated kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 624 (224.7 bits), Expect = 5.5e-61, P = 5.5e-61
 Identities = 126/300 (42%), Positives = 180/300 (60%)

Query:    32 CPSRCGDVEIPYPFGTRPGCFL--NKYFVITCNKTHYNPPKPFLRKSNIEVVNITIDGRM 89
             C +RCG+V + YPFGT PGC+   ++ F +TCN+      K F    N+ V+N+++ G++
Sbjct:    29 CQTRCGNVAVEYPFGTSPGCYYPGDESFNLTCNEQE----KLFF--GNMPVINMSLSGQL 82

Query:    90 NVMQFVAKECY-RKGNSVDSYSPTFSLSKFTVSNTENRFVVIGCDSYAYVRGYLGENRYR 148
              V    ++ CY  +G   D  +   +L  FT+S   NRF V+GC+SYA++R   G  +Y 
Sbjct:    83 RVRLVRSRVCYDSQGKQTDYIAQRTTLGNFTLSEL-NRFTVVGCNSYAFLRTS-GVEKYS 140

Query:   149 AGCMSMCDSFDFVTNGSCVGTGCCQIEIPRGLKELEVEAFSFNNHTNVSPFNPCTYASVV 208
              GC+S+CDS     NGSC G GCCQI +PRG   + V+  SF+NH  V  FNPCTYA +V
Sbjct:   141 TGCISICDSAT-TKNGSCSGEGCCQIPVPRGYSFVRVKPHSFHNHPTVHLFNPCTYAFLV 199

Query:   209 DKSQFHFSS-NYLAWEGTPEKFPLVLDWEITTKETCEEAK---ICGLNASCHKPKDNTTT 264
             +   F F +   L        FP+VLDW I  K TC++ +   +CG N++C     ++T 
Sbjct:   200 EDGMFDFHALEDLNNLRNVTTFPVVLDWSIGDK-TCKQVEYRGVCGGNSTCF----DSTG 254

Query:   265 SSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGD 324
              +GY+CKC EG+EGNPYL +GCQD+NEC   S +NC+    C+N  GS+ C C  G+  D
Sbjct:   255 GTGYNCKCLEGFEGNPYLPNGCQDINECIS-SRHNCSEHSTCENTKGSFNCNCPSGYRKD 313
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009751 "response to salicylic acid stimulus" evidence=IDA
GO:0009311 "oligosaccharide metabolic process" evidence=IMP
GO:0009826 "unidimensional cell growth" evidence=IMP
GO:0009992 "cellular water homeostasis" evidence=IMP;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016226 "iron-sulfur cluster assembly" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
TAIR|locus:2014962 WAK5 "wall associated kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014902 WAK1 "cell wall-associated kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014952 WAK4 "wall associated kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014897 WAK3 "wall associated kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032875 AT1G16260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019893 RFO1 "RESISTANCE TO FUSARIUM OXYSPORUM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200562 WAKL2 "wall associated kinase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016377 AT1G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2126316 AT4G31100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
pfam13947106 pfam13947, GUB_WAK_bind, Wall-associated receptor 4e-33
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-06
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-05
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 1e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 4e-04
pfam1294736 pfam12947, EGF_3, EGF domain 0.001
>gnl|CDD|222467 pfam13947, GUB_WAK_bind, Wall-associated receptor kinase galacturonan-binding Back     alignment and domain information 
 Score =  118 bits (298), Expect = 4e-33
 Identities = 44/108 (40%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query: 29  KPGCPSRCGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITI-DG 87
            PGCP RCG+V IPYPFG  PGC  +  F +TCN T  +PP+  L   N EV++I++ +G
Sbjct: 1   LPGCPDRCGNVSIPYPFGIGPGCARDPGFELTCNNT-TSPPRLLLGNGNYEVLSISLANG 59

Query: 88  RMNVMQFVAKECYRK-GNSVDSYSPTFSLSKFTVSNTENRFVVIGCDS 134
            + V+  ++  CY   G   D+ S +     F  S++ N+FVV+GC++
Sbjct: 60  TVRVLDPISSNCYNSSGKRTDNGSLSLGGP-FFFSSSRNKFVVVGCNT 106

This cysteine-rich GUB_WAK_bind domain is the extracellular part of this serine/threonine kinase that binds to the cell-wall pectins. Length = 106
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|205157 pfam12947, EGF_3, EGF domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 346
PF13947106 GUB_WAK_bind: Wall-associated receptor kinase gala 99.95
PF08488103 WAK: Wall-associated kinase; InterPro: IPR013695 T 99.61
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.56
KOG1214 1289 consensus Nidogen and related basement membrane pr 98.33
KOG1214 1289 consensus Nidogen and related basement membrane pr 97.84
KOG1219 4289 consensus Uncharacterized conserved protein, conta 97.8
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 97.5
KOG1219 4289 consensus Uncharacterized conserved protein, conta 97.46
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.43
KOG4260350 consensus Uncharacterized conserved protein [Funct 97.36
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.33
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.31
PF1266224 cEGF: Complement Clr-like EGF-like 97.21
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.83
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.81
KOG4260350 consensus Uncharacterized conserved protein [Funct 96.62
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 96.25
cd0005336 EGF Epidermal growth factor domain, found in epide 96.0
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 95.92
KOG4289 2531 consensus Cadherin EGF LAG seven-pass G-type recep 95.83
PF1266224 cEGF: Complement Clr-like EGF-like 95.78
smart0018135 EGF Epidermal growth factor-like domain. 95.61
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 94.06
KOG1217 487 consensus Fibrillins and related proteins containi 93.86
PF0000832 EGF: EGF-like domain This is a sub-family of the P 93.25
cd0005336 EGF Epidermal growth factor domain, found in epide 91.04
smart0017939 EGF_CA Calcium-binding EGF-like domain. 89.71
KOG1217 487 consensus Fibrillins and related proteins containi 89.26
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 88.59
smart0018135 EGF Epidermal growth factor-like domain. 87.54
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 86.26
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 86.04
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 80.8
>PF13947 GUB_WAK_bind: Wall-associated receptor kinase galacturonan-binding Back     alignment and domain information 
Probab=99.95  E-value=1.4e-28  Score=196.90  Aligned_cols=104  Identities=39%  Similarity=0.860  Sum_probs=91.0

Q ss_pred             CCCCCCCCCCccccCCCCCCCCCCCCCCCeEecCCCCCCCCeecccCCccEEEEEee-cCeEeEeeeeecccccC-Cccc
Q 044785           29 KPGCPSRCGDVEIPYPFGTRPGCFLNKYFVITCNKTHYNPPKPFLRKSNIEVVNITI-DGRMNVMQFVAKECYRK-GNSV  106 (346)
Q Consensus        29 ~~~C~~~CG~v~IpYPFgig~~C~~~~~F~l~C~~~~~~~p~l~l~~~~~~V~~is~-~~~~~v~~~~~~~c~~~-~~~~  106 (346)
                      +++||++||||+||||||||++|+++|+|+|+|+++ +++|+|++.+.+|+|++|+| +++++|..++.+.|+.. ....
T Consensus         1 ~~~C~~~CGnv~IpYPFgi~~~C~~~~~F~L~C~~~-~~~~~l~l~~~~~~V~~I~~~~~~i~v~~~~~~~~~~~~~~~~   79 (106)
T PF13947_consen    1 KPGCPSSCGNVSIPYPFGIGPGCGRDPGFELTCNNN-TSPPKLLLSSGNYEVLSISYENGTIRVSDPISSNCYSSSSSNS   79 (106)
T ss_pred             CCCCCCccCCEeecCCCccCCCCCCCCCcEEECCCC-CCCceeEecCCcEEEEEEecCCCEEEEEeccccceecCCCCcc
Confidence            478999999999999999999999999999999988 67899999889999999999 99999999999998876 2222


Q ss_pred             ccccceeCCCceEeccCCCEEEEEcccc
Q 044785          107 DSYSPTFSLSKFTVSNTENRFVVIGCDS  134 (346)
Q Consensus       107 ~~~~~~l~~~pf~~s~~~n~~~~~gC~~  134 (346)
                      ....|++.+ ||.+|+.+|+|+++||++
T Consensus        80 ~~~~~~~~~-~~~~s~~~N~~~~~GC~t  106 (106)
T PF13947_consen   80 SNSNLSLNG-PFFFSSSSNKFTVVGCNT  106 (106)
T ss_pred             cccEEeecC-CceEccCCcEEEEECCCC
Confidence            234566666 899998899999999985

>PF08488 WAK: Wall-associated kinase; InterPro: IPR013695 This domain is found together with the eukaryotic protein kinase domain IPR000719 from INTERPRO in plant wall-associated kinases (WAKs) and related proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1219 consensus Uncharacterized conserved protein, contains laminin, cadherin and EGF domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG4260 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG4289 consensus Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms] Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1217 consensus Fibrillins and related proteins containing Ca2+-binding EGF-like domains [Signal transduction mechanisms] Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
2bo2_A143 Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst 6e-05
3p5b_L 400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 6e-05
3p5c_L 440 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 7e-05
3m0c_C 791 The X-Ray Crystal Structure Of Pcsk9 In Complex Wit 1e-04
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 2e-04
1n7d_A 699 Extracellular Domain Of The Ldl Receptor Length = 6 2e-04
2w2n_E107 Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr 3e-04
2w2m_E107 Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 4e-04
1hz8_A82 Solution Structure And Backbone Dynamics Of A Conca 5e-04
3gcw_E83 Pcsk9:egfa(H306y) Length = 83 5e-04
3bps_E83 Pcsk9:egf-a Complex Length = 83 6e-04
1hj7_A80 Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep 6e-04
>pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 44/94 (46%), Gaps = 10/94 (10%)
Query: 237 ITTKETCEEAKICGL--NASCHKPKDNTTTSSGYHCKCNEGYE---GNPYL----SDGCQ 287
            T  ETC++   C      SC K  D   T   Y C C+ GYE   G         + CQ
Sbjct: 35  TTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQ 94
Query: 288 DVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGF 321
           DV+EC     + C  + +C N  GSY+CRCR G+
Sbjct: 95  DVDECSS-GQHQCDSSTVCFNTVGSYSCRCRPGW 127
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 Back     alignment and structure
>pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 Back     alignment and structure
>pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 Back     alignment and structure
>pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 Back     alignment and structure
>pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 Back     alignment and structure
>pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 Back     alignment and structure
>pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 Back     alignment and structure
>pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-17
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 8e-08
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-14
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 5e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 9e-11
1uzk_A 162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-06
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-14
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-13
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 6e-14
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 2e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 5e-04
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 7e-14
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-09
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 4e-12
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 5e-10
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 4e-12
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 2e-07
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-11
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-06
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 8e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 5e-09
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-08
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 3e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 3e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 6e-07
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-06
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 5e-04
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-06
2vh0_B134 Activated factor XA light chain; serine protease, 6e-06
2vh0_B134 Activated factor XA light chain; serine protease, 1e-05
3v65_B 386 Low-density lipoprotein receptor-related protein; 7e-06
3v65_B 386 Low-density lipoprotein receptor-related protein; 8e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 8e-06
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-05
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-05
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 3e-04
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-05
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 5e-05
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-05
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 2e-04
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-04
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 4e-04
3fby_A 551 COMP, cartilage oligomeric matrix protein; signatu 6e-04
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 9e-04
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
 Score = 75.4 bits (186), Expect = 2e-17
 Identities = 26/91 (28%), Positives = 35/91 (38%), Gaps = 10/91 (10%)

Query: 243 CEEAKICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTR 302
           C  +        C     NT     + CKC+EGYE    +   C D++EC+        R
Sbjct: 6   CRISPDLCGRGQCV----NTPGD--FECKCDEGYESGFMMMKNCMDIDECQRD--PLLCR 57

Query: 303 THICDNIPGSYTCRCRKGFHGDGTKDGRGCI 333
             +C N  GSY C C  G       +   CI
Sbjct: 58  GGVCHNTEGSYRCECPPGHQLSP--NISACI 86
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Length = 105 Back     alignment and structure
>3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} Length = 551 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.12
2bou_A143 EGF-like module containing mucin-like hormone rece 99.0
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.98
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.79
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.77
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.77
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.75
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.7
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.69
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.65
2bou_A143 EGF-like module containing mucin-like hormone rece 98.56
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.55
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.55
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.54
2vh0_B134 Activated factor XA light chain; serine protease, 98.53
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.49
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.47
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.47
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.47
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.45
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.41
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.39
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.3
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.28
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.28
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.27
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.24
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.21
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.02
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.93
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.91
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.8
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.61
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.61
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 97.6
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.55
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.51
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.46
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.41
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 97.39
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.38
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 97.37
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.26
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.16
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.15
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.07
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.07
1szb_A170 Mannose binding lectin-associated serine protease- 96.87
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 96.86
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.85
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.85
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.84
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.82
1nzi_A159 Complement C1S component; calcium, innate immunity 96.79
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.6
4fbr_A 267 Lectin, myxobacterial hemagglutinin; beta-barrel, 96.52
1ob1_C99 Major merozoite surface protein; immune system, im 96.51
2vh0_B134 Activated factor XA light chain; serine protease, 96.44
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.38
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.06
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.04
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.88
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 95.34
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 95.22
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 95.06
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 94.94
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 94.86
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 94.4
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 93.99
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.76
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 93.63
2wph_E59 Coagulation factor IXA light chain; serine proteas 93.55
2k2s_B61 Micronemal protein 6; microneme protein complex, c 93.49
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 93.47
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 93.42
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 93.22
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 93.11
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 92.91
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 92.89
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 92.87
1a3p_A45 Epidermal growth factor; disulfide connectivities, 92.81
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 91.8
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 91.17
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 91.09
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 90.71
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 90.57
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 90.53
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 90.12
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 89.82
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 89.04
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 88.28
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 86.07
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 86.06
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 85.76
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 85.46
1nql_B53 Epidermal growth factor; cell surface receptor, ty 85.42
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 84.85
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 84.28
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 82.02
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 81.82
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 81.38
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 81.37
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 80.24
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 80.21
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
Probab=99.12  E-value=5.5e-11  Score=90.08  Aligned_cols=80  Identities=31%  Similarity=0.845  Sum_probs=61.6

Q ss_pred             cCccC-CCCCCCCeeeCCCCCCCCCCCeeeecCCCcccCCCCCCCceeCccCCCCCCCCCCCCCeeEecCCCeEEecCCC
Q 044785          242 TCEEA-KICGLNASCHKPKDNTTTSSGYHCKCNEGYEGNPYLSDGCQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKG  320 (346)
Q Consensus       242 ~C~~~-~~C~~~s~C~~~~~~~~~~~gy~C~C~~Gy~gnp~~~~gC~dideC~~~~~~~C~~~~~C~nt~G~y~C~C~~G  320 (346)
                      .|... ..|. ++.|++..+      +|+|.|++||.+++.....|+|||||.. ....|. ++.|+|+.|+|+|.|++|
T Consensus         5 eC~~~~~~C~-~g~C~n~~g------~y~C~C~~Gy~~~~~~g~~C~dideC~~-~~~~C~-~~~C~n~~g~y~C~C~~G   75 (86)
T 1lmj_A            5 ECRISPDLCG-RGQCVNTPG------DFECKCDEGYESGFMMMKNCMDIDECQR-DPLLCR-GGVCHNTEGSYRCECPPG   75 (86)
T ss_dssp             TTTTCSSTTT-TSCEEEETT------EEEECCCSSEEECTTTSSSEEECCHHHH-CSSTTT-TSEEEEETTEEEEESCTT
T ss_pred             cccCCCCCCC-CCEEECCCC------CEEeeCCCCcCccCCCCCccCCcccccC-CCCcCC-CCEeEcCCCCEEEECcCC
Confidence            46542 3474 458988776      8999999999987654457999999954 444575 579999999999999999


Q ss_pred             CccCCCCCCCCc
Q 044785          321 FHGDGTKDGRGC  332 (346)
Q Consensus       321 ~~~~~~~~~~~C  332 (346)
                      |.++.  +.+.|
T Consensus        76 ~~~~~--~~~~C   85 (86)
T 1lmj_A           76 HQLSP--NISAC   85 (86)
T ss_dssp             SCCCS--SSCCC
T ss_pred             cccCC--CCCcc
Confidence            99877  33555
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 346
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 3e-08
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 1e-07
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 2e-07
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-07
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-07
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 4e-07
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 6e-07
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 8e-07
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 1e-06
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 2e-06
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 3e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 3e-06
d3bpse140 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) 2e-05
d1gl4a240 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 5e-05
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 2e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 3e-04
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 4e-04
d1ijqa250 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) 6e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 0.004
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.1 bits (112), Expect = 3e-08
 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 3/42 (7%)

Query: 286 CQDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTK 327
             D++EC++    +  +   C N  GSY C C  G+   G +
Sbjct: 2   AVDMDECKE---PDVCKHGQCINTDGSYRCECPFGYILAGNE 40
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.69
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.66
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.61
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.54
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.54
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.52
d1nt0a345 Mannose-binding protein associated serine protease 98.47
d1szba245 Mannose-binding protein associated serine protease 98.42
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.14
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.09
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.04
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.97
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.96
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.71
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.67
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.61
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.58
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.46
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.22
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.16
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.06
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.95
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.92
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 96.9
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.88
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.79
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 96.64
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.49
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.44
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.43
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 95.98
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 95.7
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.58
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 95.2
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 95.1
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.08
d1i0ua241 Low density lipoprotein (LDL) receptor, different 94.98
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 94.9
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 94.76
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 94.53
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.52
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 94.33
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.19
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 94.1
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 94.05
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.35
d1nt0a345 Mannose-binding protein associated serine protease 92.5
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 92.29
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 92.15
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.86
d1szba245 Mannose-binding protein associated serine protease 91.85
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 91.05
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 90.01
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 89.49
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 89.33
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 88.33
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 88.06
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 87.57
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 87.01
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 85.92
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 84.58
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 83.25
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 82.84
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 81.7
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.74  E-value=2.9e-09  Score=67.97  Aligned_cols=43  Identities=30%  Similarity=0.793  Sum_probs=34.4

Q ss_pred             eeCccCCCCCCCCCCCCCeeEecCCCeEEecCCCCccCCCCCCCCc
Q 044785          287 QDVNECEDPSLNNCTRTHICDNIPGSYTCRCRKGFHGDGTKDGRGC  332 (346)
Q Consensus       287 ~dideC~~~~~~~C~~~~~C~nt~G~y~C~C~~G~~~~~~~~~~~C  332 (346)
                      .|||||.. ..+.|. ++.|+|++|+|+|.|++||+++... ++.|
T Consensus         1 TDidEC~~-~~~~C~-~~~C~Nt~Gsy~C~C~~Gy~~~~~~-g~~C   43 (44)
T d1lmja1           1 TDIDECRI-SPDLCG-RGQCVNTPGDFECKCDEGYESGFMM-MKNC   43 (44)
T ss_dssp             CCCCTTTT-CSSTTT-TSCEEEETTEEEECCCSSEEECTTT-SSSE
T ss_pred             CcccccCC-CCCCCC-CCEeEcCCCCeEEeCCCCCccCCCC-CCcC
Confidence            48999975 567774 5789999999999999999987533 4455
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure