Citrus Sinensis ID: 044790

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--

MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHSSSGSGSESCIMTQKSTKSKNAEGSDNNSGSNDEDDKGSIGLNIQDGSDNGSGTQLSSMGNN

cEEEEEccHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccc

MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRK****************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHSSSGSGSESCIMTQKSTKSKNAEGSDNNSGSNDEDDKGSIGLNIQDGSDNGSGTQLSSMGNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Two-component response regulator-like APRR7	Controls photoperiodic flowering response. Seems to be one of the component of the circadian clock. Expression of several members of the ARR-like family is controlled by circadian rhythm. The particular coordinated sequential expression of APRR9, APRR7, APRR5, APRR3 and APPR1 result to circadian waves that may be at the basis of the endogenous circadian clock.	probable	Q93WK5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LUF, chain A
Confidence level:very confident
Coverage over the Query: 1-101
View the alignment between query and template
View the model in PyMOL