Citrus Sinensis ID: 044790

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHSSSGSGSESCIMTQKSTKSKNAEGSDNNSGSNDEDDKGSIGLNIQDGSDNGSGTQLSSMGNN
cEEEEEccHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccc
ccEEEccHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccHHHHEEccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMnhktcknipvimmssHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRkchsssgsgsescimtqkstksknaegsdnnsgsndeddkgsiglniqdgsdngsgtqlssmgnn
MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHsssgsgsesciMTQKstksknaegsdnnsgsndedDKGSiglniqdgsdngsgtqlssmgnn
MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHsssgsgsesCIMTQKSTKSKnaegsdnnsgsndeddkgsIGLNIQDGSDNGSGTQLSSMGNN
**VIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKC***************************************************************
MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHV*******************************************************************
MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRK*************************************DKGSIGLNIQDGSDN************
*AVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCH**************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHSSSGSGSESCIMTQKSTKSKNAEGSDNNSGSNDEDDKGSIGLNIQDGSDNGSGTQLSSMGNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query162 2.2.26 [Sep-21-2011]
Q10N34 767 Two-component response re yes no 0.956 0.202 0.684 3e-51
A2XFB7 767 Two-component response re N/A no 0.956 0.202 0.684 4e-51
Q93WK5 727 Two-component response re yes no 0.956 0.213 0.711 1e-49
A2YQ93 742 Two-component response re N/A no 0.962 0.210 0.721 6e-49
Q0D3B6 742 Two-component response re no no 0.962 0.210 0.715 7e-49
Q9LVG4 495 Two-component response re no no 0.956 0.313 0.685 2e-47
Q689G6 623 Two-component response re no no 0.617 0.160 0.66 1e-32
Q8L500 468 Two-component response re no no 0.592 0.205 0.572 4e-31
Q6LA42 558 Two-component response re no no 0.802 0.232 0.477 2e-30
Q689G9 518 Two-component response re no no 0.746 0.233 0.366 3e-17
>sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1 Back     alignment and function desciption
 Score =  200 bits (509), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 129/165 (78%), Gaps = 10/165 (6%)

Query: 3   VIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHD 62
           VI  ENGL AW+ LEDL + IDLVLTEV+MP LSGIGLL KI +HK CK+IPVIMMSS+D
Sbjct: 107 VIPAENGLHAWQCLEDLQNHIDLVLTEVVMPRLSGIGLLSKITSHKICKDIPVIMMSSND 166

Query: 63  SMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHSSSGSGSESCIMTQKSTKSKNA 122
           SM  VFKCLSKGAV FLVKPIRKNEL+NLWQHVWR+CHSSSGSGSES I TQK TK K  
Sbjct: 167 SMGTVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGIRTQKCTKPKVD 226

Query: 123 EGSDNNSGSNDEDDKG----------SIGLNIQDGSDNGSGTQLS 157
           +  +NNSGSN++++            S+G N +DGSDNGSGTQ S
Sbjct: 227 DEYENNSGSNNDNEDDDDNDEDDDDLSVGHNARDGSDNGSGTQSS 271
Controls photoperiodic flowering response. Seems to be one of the component of the circadian clock. Expression of several members of the ARR-like family is controlled by circadian rhythm. The particular coordinated sequential expression of PRR73, PRR37, PRR95, PRR59 and PPR1 result to circadian waves that may be at the basis of the endogenous circadian clock.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2 Back     alignment and function description
>sp|Q93WK5|APRR7_ARATH Two-component response regulator-like APRR7 OS=Arabidopsis thaliana GN=APRR7 PE=2 SV=1 Back     alignment and function description
>sp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2 Back     alignment and function description
>sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1 Back     alignment and function description
>sp|Q689G6|PRR95_ORYSJ Two-component response regulator-like PRR95 OS=Oryza sativa subsp. japonica GN=PRR95 PE=2 SV=1 Back     alignment and function description
>sp|Q8L500|APRR9_ARATH Two-component response regulator-like APRR9 OS=Arabidopsis thaliana GN=APRR9 PE=2 SV=2 Back     alignment and function description
>sp|Q6LA42|APRR5_ARATH Two-component response regulator-like APRR5 OS=Arabidopsis thaliana GN=APRR5 PE=1 SV=2 Back     alignment and function description
>sp|Q689G9|PRR1_ORYSJ Two-component response regulator-like PRR1 OS=Oryza sativa subsp. japonica GN=PRR1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
255568149 659 Two-component response regulator ARR2, p 0.950 0.233 0.796 6e-62
224098134 711 predicted protein [Populus trichocarpa] 0.956 0.218 0.787 3e-61
224098126 766 pseudo response regulator [Populus trich 0.956 0.202 0.787 3e-61
255568450 762 sensory transduction histidine kinase, p 0.956 0.203 0.8 1e-60
449524812 794 PREDICTED: two-component response regula 0.956 0.195 0.796 2e-60
449448936 797 PREDICTED: two-component response regula 0.956 0.194 0.796 4e-60
356536913 747 PREDICTED: two-component response regula 0.956 0.207 0.812 1e-59
356545957 749 PREDICTED: two-component response regula 0.956 0.206 0.8 6e-59
225435163 785 PREDICTED: two-component response regula 0.956 0.197 0.774 1e-57
319657108 718 pseudo-response regulator 7-like protein 0.956 0.215 0.741 2e-57
>gi|255568149|ref|XP_002525050.1| Two-component response regulator ARR2, putative [Ricinus communis] gi|223535631|gb|EEF37297.1| Two-component response regulator ARR2, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  241 bits (616), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 125/157 (79%), Positives = 139/157 (88%), Gaps = 3/157 (1%)

Query: 1   MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSS 60
           MAV AV NGLQAWK+LEDL + IDL+L+EV MPCLSGIGLL KIMNH+TCKNIPVIMMSS
Sbjct: 1   MAVTAVANGLQAWKLLEDLTNHIDLILSEVAMPCLSGIGLLCKIMNHRTCKNIPVIMMSS 60

Query: 61  HDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHSSSGSGSESCIMTQKSTKSK 120
           HDSM++VFKCLSKGA+ FLVKPIRKNEL+NLWQHVWRKCHSSSGSGSES I T+KST   
Sbjct: 61  HDSMNVVFKCLSKGALDFLVKPIRKNELKNLWQHVWRKCHSSSGSGSESDIRTRKST--- 117

Query: 121 NAEGSDNNSGSNDEDDKGSIGLNIQDGSDNGSGTQLS 157
           + E SDNN+GSNDEDD GS GLN +DGSD+GSGTQ S
Sbjct: 118 SPEESDNNTGSNDEDDIGSTGLNARDGSDHGSGTQSS 154

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224098134|ref|XP_002311124.1| predicted protein [Populus trichocarpa] gi|222850944|gb|EEE88491.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098126|ref|XP_002311123.1| pseudo response regulator [Populus trichocarpa] gi|222850943|gb|EEE88490.1| pseudo response regulator [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255568450|ref|XP_002525199.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223535496|gb|EEF37165.1| sensory transduction histidine kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449524812|ref|XP_004169415.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448936|ref|XP_004142221.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356536913|ref|XP_003536977.1| PREDICTED: two-component response regulator-like APRR7-like [Glycine max] Back     alignment and taxonomy information
>gi|356545957|ref|XP_003541399.1| PREDICTED: two-component response regulator-like APRR7-like [Glycine max] Back     alignment and taxonomy information
>gi|225435163|ref|XP_002281776.1| PREDICTED: two-component response regulator-like PRR73-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|319657108|gb|ADV58932.1| pseudo-response regulator 7-like protein [Beta vulgaris subsp. vulgaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query162
TAIR|locus:2151206 727 PRR7 "pseudo-response regulato 0.956 0.213 0.596 1.1e-44
TAIR|locus:2044376 468 PRR9 "pseudo-response regulato 0.592 0.205 0.572 1.9e-30
TAIR|locus:2163198 618 TOC1 "TIMING OF CAB EXPRESSION 0.592 0.155 0.447 2e-16
UNIPROTKB|Q4GZK8131 rr3 "Type A response regulator 0.586 0.725 0.333 1.3e-11
TAIR|locus:2065398 382 RR14 "response regulator 14" [ 0.530 0.225 0.426 1.9e-11
TAIR|locus:2130095 664 RR2 "response regulator 2" [Ar 0.512 0.125 0.409 2.5e-11
TAIR|locus:2093668 690 RR1 "response regulator 1" [Ar 0.438 0.102 0.447 2.6e-11
UNIPROTKB|Q4GZL0231 rr1 "Type A response regulator 0.567 0.398 0.386 1.2e-10
TAIR|locus:2011286206 ARR7 "response regulator 7" [A 0.549 0.432 0.344 1.2e-10
TAIR|locus:2116587 552 RR10 "response regulator 10" [ 0.567 0.166 0.375 1.3e-10
TAIR|locus:2151206 PRR7 "pseudo-response regulator 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 462 (167.7 bits), Expect = 1.1e-44, Sum P(2) = 1.1e-44
 Identities = 93/156 (59%), Positives = 106/156 (67%)

Query:     3 VIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHD 62
             V+   NG+QAWK+LEDL + ID+VLTEV+MP LSGIGLL KI+NHK+ +NIPVIMMSSHD
Sbjct:   104 VVEASNGIQAWKVLEDLNNHIDIVLTEVIMPYLSGIGLLCKILNHKSRRNIPVIMMSSHD 163

Query:    63 SMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKCHXXXXXXXXXCI-MTQKSTKSKX 121
             SM +VFKCLSKGAV FLVKPIRKNEL+ LWQHVWR+C              TQKS KSK 
Sbjct:   164 SMGLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCQSSSGSGSESGTHQTQKSVKSKS 223

Query:   122 XXXXXXXXXXXXXXXXXXIGLNIQDGSDNGSGTQLS 157
                               IGLN  DGS +GSG Q S
Sbjct:   224 IKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSS 259
GO:0000156 "phosphorelay response regulator activity" evidence=IEA;ISS
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;TAS
GO:0007623 "circadian rhythm" evidence=IMP;TAS
GO:0010017 "red or far-red light signaling pathway" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
GO:0009266 "response to temperature stimulus" evidence=IGI
GO:0003677 "DNA binding" evidence=IPI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
GO:0009639 "response to red or far red light" evidence=RCA
GO:0042752 "regulation of circadian rhythm" evidence=RCA
GO:0048574 "long-day photoperiodism, flowering" evidence=RCA
TAIR|locus:2044376 PRR9 "pseudo-response regulator 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163198 TOC1 "TIMING OF CAB EXPRESSION 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4GZK8 rr3 "Type A response regulator 3" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
TAIR|locus:2065398 RR14 "response regulator 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4GZL0 rr1 "Type A response regulator 1" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
TAIR|locus:2011286 ARR7 "response regulator 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93WK5APRR7_ARATHNo assigned EC number0.71150.95670.2132yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
cd00156113 cd00156, REC, Signal receiver domain; originally t 2e-20
pfam00072111 pfam00072, Response_reg, Response regulator receiv 1e-18
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal tra 3e-17
COG2204 464 COG2204, AtoC, Response regulator containing CheY- 8e-15
COG0745229 COG0745, OmpR, Response regulators consisting of a 3e-12
PLN03029222 PLN03029, PLN03029, type-a response regulator prot 3e-12
COG3437 360 COG3437, COG3437, Response regulator containing a 5e-11
COG3706 435 COG3706, PleD, Response regulator containing a Che 6e-11
TIGR02875262 TIGR02875, spore_0_A, sporulation transcription fa 2e-10
TIGR01818 463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 3e-10
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 3e-10
PRK00742 354 PRK00742, PRK00742, chemotaxis-specific methyleste 9e-10
COG2197211 COG2197, CitB, Response regulator containing a Che 1e-09
COG4753 475 COG4753, COG4753, Response regulator containing Ch 2e-09
COG4566202 COG4566, TtrR, Response regulator [Signal transduc 5e-08
PRK12555 337 PRK12555, PRK12555, chemotaxis-specific methyleste 3e-07
TIGR02154226 TIGR02154, PhoB, phosphate regulon transcriptional 4e-07
PRK10693 303 PRK10693, PRK10693, response regulator of RpoS; Pr 5e-07
PRK10365 441 PRK10365, PRK10365, transcriptional regulatory pro 6e-07
COG2201 350 COG2201, CheB, Chemotaxis response regulator conta 6e-07
COG4565224 COG4565, CitB, Response regulator of citrate/malat 6e-07
PRK09390202 PRK09390, fixJ, response regulator FixJ; Provision 1e-06
PRK15115 444 PRK15115, PRK15115, response regulator GlrR; Provi 1e-06
CHL00148240 CHL00148, orf27, Ycf27; Reviewed 4e-06
PRK10955232 PRK10955, PRK10955, DNA-binding transcriptional re 4e-06
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regula 4e-06
PRK11517223 PRK11517, PRK11517, transcriptional regulatory pro 6e-05
PRK15479221 PRK15479, PRK15479, transcriptional regulatory pro 9e-05
PRK10430239 PRK10430, PRK10430, DNA-binding transcriptional ac 2e-04
PRK10923 469 PRK10923, glnG, nitrogen regulation protein NR(I); 2e-04
COG3947 361 COG3947, COG3947, Response regulator containing Ch 4e-04
COG3279244 COG3279, LytT, Response regulator of the LytR/AlgR 4e-04
PRK10360196 PRK10360, PRK10360, DNA-binding transcriptional ac 4e-04
PRK10161229 PRK10161, PRK10161, transcriptional regulator PhoB 7e-04
TIGR01387218 TIGR01387, cztR_silR_copR, heavy metal response re 0.001
>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information 
 Score = 80.3 bits (199), Expect = 2e-20
 Identities = 27/95 (28%), Positives = 49/95 (51%), Gaps = 4/95 (4%)

Query: 1   MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSS 60
             V+  E+G +A  +L +   + DL+L +++MP + G+ LLR+I       +IP+I +++
Sbjct: 22  YEVVEAEDGEEALALLAEE--KPDLILLDIMMPGMDGLELLRRIRKRG--PDIPIIFLTA 77

Query: 61  HDSMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHV 95
           H       + L  GA  +L KP    EL    + +
Sbjct: 78  HGDDEDAVEALKAGADDYLTKPFSPEELLARIRAL 112

Length = 113
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|215544 PLN03029, PLN03029, type-a response regulator protein; Provisional Back     alignment and domain information
>gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226932 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|237135 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226931 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|182454 PRK10430, PRK10430, DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>gnl|CDD|226456 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225818 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182408 PRK10360, PRK10360, DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>gnl|CDD|182277 PRK10161, PRK10161, transcriptional regulator PhoB; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 162
COG0745229 OmpR Response regulators consisting of a CheY-like 99.88
COG4753 475 Response regulator containing CheY-like receiver d 99.81
COG2204 464 AtoC Response regulator containing CheY-like recei 99.78
PF00072112 Response_reg: Response regulator receiver domain; 99.77
COG3437 360 Response regulator containing a CheY-like receiver 99.75
COG4566202 TtrR Response regulator [Signal transduction mecha 99.74
COG2197211 CitB Response regulator containing a CheY-like rec 99.73
COG4565224 CitB Response regulator of citrate/malate metaboli 99.73
COG3706 435 PleD Response regulator containing a CheY-like rec 99.7
PRK10046225 dpiA two-component response regulator DpiA; Provis 99.68
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 99.68
KOG0519786 consensus Sensory transduction histidine kinase [S 99.65
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 99.65
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 99.65
PRK09836227 DNA-binding transcriptional activator CusR; Provis 99.63
PRK11173237 two-component response regulator; Provisional 99.63
PLN03029222 type-a response regulator protein; Provisional 99.62
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 99.62
PRK10161229 transcriptional regulator PhoB; Provisional 99.62
PRK10529225 DNA-binding transcriptional activator KdpE; Provis 99.61
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 99.61
PRK10766221 DNA-binding transcriptional regulator TorR; Provis 99.61
PRK09468239 ompR osmolarity response regulator; Provisional 99.6
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 99.6
PRK10841924 hybrid sensory kinase in two-component regulatory 99.6
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 99.6
PRK10840216 transcriptional regulator RcsB; Provisional 99.6
TIGR01387218 cztR_silR_copR heavy metal response regulator. Mem 99.6
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 99.59
PRK10693 303 response regulator of RpoS; Provisional 99.59
PRK09581 457 pleD response regulator PleD; Reviewed 99.59
TIGR02875262 spore_0_A sporulation transcription factor Spo0A. 99.58
COG3947 361 Response regulator containing CheY-like receiver a 99.58
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 99.58
PRK10701240 DNA-binding transcriptional regulator RstA; Provis 99.58
PRK11083228 DNA-binding response regulator CreB; Provisional 99.58
PRK13856241 two-component response regulator VirG; Provisional 99.57
PRK10955232 DNA-binding transcriptional regulator CpxR; Provis 99.56
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 99.56
PRK11517223 transcriptional regulatory protein YedW; Provision 99.55
PRK15347921 two component system sensor kinase SsrA; Provision 99.55
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 99.55
PRK09483217 response regulator; Provisional 99.55
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 99.54
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 99.54
CHL00148240 orf27 Ycf27; Reviewed 99.54
PRK14084246 two-component response regulator; Provisional 99.54
PRK09935210 transcriptional regulator FimZ; Provisional 99.52
PRK15115 444 response regulator GlrR; Provisional 99.5
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 99.49
PRK11091779 aerobic respiration control sensor protein ArcB; P 99.49
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 99.49
PRK099591197 hybrid sensory histidine kinase in two-component r 99.48
PRK10365 441 transcriptional regulatory protein ZraR; Provision 99.48
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 99.48
PRK09581 457 pleD response regulator PleD; Reviewed 99.48
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 99.48
PRK15479221 transcriptional regulatory protein TctD; Provision 99.47
COG4567182 Response regulator consisting of a CheY-like recei 99.47
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 99.45
PRK11697238 putative two-component response-regulatory protein 99.45
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 99.43
PRK12555 337 chemotaxis-specific methylesterase; Provisional 99.42
PRK10403215 transcriptional regulator NarP; Provisional 99.4
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.4
PRK10651216 transcriptional regulator NarL; Provisional 99.4
PRK09390202 fixJ response regulator FixJ; Provisional 99.4
PRK15369211 two component system sensor kinase SsrB; Provision 99.38
PRK00742 354 chemotaxis-specific methylesterase; Provisional 99.36
PRK13558 665 bacterio-opsin activator; Provisional 99.36
PRK13435145 response regulator; Provisional 99.35
COG3707194 AmiR Response regulator with putative antiterminat 99.31
PRK15411207 rcsA colanic acid capsular biosynthesis activation 99.3
cd00156113 REC Signal receiver domain; originally thought to 99.25
COG2201 350 CheB Chemotaxis response regulator containing a Ch 99.25
PRK13837828 two-component VirA-like sensor kinase; Provisional 99.24
PRK09191261 two-component response regulator; Provisional 99.18
PRK13557540 histidine kinase; Provisional 99.13
COG3279244 LytT Response regulator of the LytR/AlgR family [T 99.0
PRK15029 755 arginine decarboxylase; Provisional 98.91
COG3706 435 PleD Response regulator containing a CheY-like rec 98.9
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 97.91
PF03709115 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal 97.6
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 96.97
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 96.95
PRK02261137 methylaspartate mutase subunit S; Provisional 96.29
TIGR03815 322 CpaE_hom_Actino helicase/secretion neighborhood Cp 96.05
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 96.0
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 95.93
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 95.2
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 95.12
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 94.97
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 94.93
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 94.32
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 94.2
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 93.93
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 93.77
PRK00208250 thiG thiazole synthase; Reviewed 93.74
PRK15399 713 lysine decarboxylase LdcC; Provisional 93.69
COG3836255 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 93.63
PRK09426714 methylmalonyl-CoA mutase; Reviewed 93.52
PF03328221 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family 93.43
PRK15400 714 lysine decarboxylase CadA; Provisional 93.27
smart0044855 REC cheY-homologous receiver domain. CheY regulate 93.0
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 93.0
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 92.89
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 92.6
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 92.4
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 92.24
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 92.21
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 92.19
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 92.18
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 91.59
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 91.51
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 91.27
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 90.96
PRK12704 520 phosphodiesterase; Provisional 90.82
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 90.52
PLN02591250 tryptophan synthase 90.4
PLN02274 505 inosine-5'-monophosphate dehydrogenase 90.37
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 90.32
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 90.28
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 89.99
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 89.97
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 89.9
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 89.74
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 89.72
PRK06096284 molybdenum transport protein ModD; Provisional 89.55
PRK07695201 transcriptional regulator TenI; Provisional 89.52
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 89.47
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 89.3
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 89.0
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 88.89
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 88.82
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 88.79
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 88.43
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 88.11
TIGR01334277 modD putative molybdenum utilization protein ModD. 88.08
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 88.05
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 87.81
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 87.33
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 87.15
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 86.94
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 86.75
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 86.64
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 86.61
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 86.59
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 86.41
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 86.37
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 86.06
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 86.0
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 85.97
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 85.47
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 85.31
cd02068127 radical_SAM_B12_BD B12 binding domain_like associa 85.0
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 84.84
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 84.83
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 84.79
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 84.78
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 84.58
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 84.56
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 84.24
PRK06806281 fructose-bisphosphate aldolase; Provisional 84.17
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 83.48
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 83.11
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 83.07
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 82.89
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 82.76
PRK08185283 hypothetical protein; Provisional 82.38
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 82.15
COG4999140 Uncharacterized domain of BarA-like signal transdu 82.08
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 82.05
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 82.0
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 81.81
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 81.73
TIGR00642619 mmCoA_mut_beta methylmalonyl-CoA mutase, heterodim 81.7
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 81.6
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 81.57
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 81.42
CHL00162267 thiG thiamin biosynthesis protein G; Validated 81.41
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 81.33
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 81.07
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 80.91
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 80.88
PRK09016296 quinolinate phosphoribosyltransferase; Validated 80.86
PF02887117 PK_C: Pyruvate kinase, alpha/beta domain; InterPro 80.67
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 80.32
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 80.19
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 80.15
PF14606178 Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase fami 80.07
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information 
Probab=99.88  E-value=4.2e-22  Score=151.36  Aligned_cols=97  Identities=25%  Similarity=0.388  Sum_probs=91.7

Q ss_pred             CEEEEEcCHHHHHHHHHhhCCCccEEEEcCCCCCCCHHHHHHHHHccCCCCCCcEEEEecCCCHHHHHHHHHcCCceEEe
Q 044790            1 MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLV   80 (162)
Q Consensus         1 ~~v~~a~~~~eal~~l~~~~~~~DlvllD~~mp~~~g~~~~~~ir~~~~~~~~piI~lt~~~~~~~~~~a~~~Ga~~~l~   80 (162)
                      |+|..+.++.+|++.+..  . ||+||+|++||+++|+++|++||+. ....+|||++|+..+......++++||||||.
T Consensus        25 ~~v~~~~~~~~a~~~~~~--~-~dlviLD~~lP~~dG~~~~~~iR~~-~~~~~PIi~Lta~~~~~d~v~gl~~GADDYl~  100 (229)
T COG0745          25 YEVDVAADGEEALEAARE--Q-PDLVLLDLMLPDLDGLELCRRLRAK-KGSGPPIIVLTARDDEEDRVLGLEAGADDYLT  100 (229)
T ss_pred             CEEEEECCHHHHHHHHhc--C-CCEEEEECCCCCCCHHHHHHHHHhh-cCCCCcEEEEECCCcHHHHHHHHhCcCCeeee
Confidence            789999999999999998  8 9999999999999999999999965 44789999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHhccC
Q 044790           81 KPIRKNELQNLWQHVWRKCHS  101 (162)
Q Consensus        81 KP~~~~~L~~~i~~~l~~~~~  101 (162)
                      |||++.+|.++|+.++++...
T Consensus       101 KPf~~~EL~ARi~a~lRR~~~  121 (229)
T COG0745         101 KPFSPRELLARLRALLRRNAG  121 (229)
T ss_pred             CCCCHHHHHHHHHHHHCcCcC
Confidence            999999999999999998764

>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>COG3836 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>PF03328 HpcH_HpaI: HpcH/HpaI aldolase/citrate lyase family; InterPro: IPR005000 This family includes 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (4 Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00642 mmCoA_mut_beta methylmalonyl-CoA mutase, heterodimeric type, beta chain Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PF02887 PK_C: Pyruvate kinase, alpha/beta domain; InterPro: IPR015795 Pyruvate kinase (2 Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PF14606 Lipase_GDSL_3: GDSL-like Lipase/Acylhydrolase family; PDB: 3SKV_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
3f7a_A 394 Structure Of Orthorhombic Crystal Form Of Pseudomon 3e-07
1w25_A 459 Response Regulator Pled In Complex With C-digmp Len 6e-07
2wb4_A 459 Activated Diguanylate Cyclase Pled In Complex With 7e-07
3eq2_A 394 Structure Of Hexagonal Crystal Form Of Pseudomonas 2e-06
3gwg_A129 Crystal Structure Of Chey Of Helicobacter Pylori Le 2e-06
3h1g_A129 Crystal Structure Of Chey Mutant T84a Of Helicobact 2e-06
3h1f_A129 Crystal Structure Of Chey Mutant D53a Of Helicobact 3e-06
3jte_A143 Crystal Structure Of Response Regulator Receiver Do 1e-05
3gt7_A154 Crystal Structure Of Signal Receiver Domain Of Sign 3e-05
1l5y_A155 Crystal Structure Of Mg2+ / Bef3-bound Receiver Dom 4e-05
1j56_A124 Minimized Average Structure Of Beryllofluoride-Acti 5e-05
1dc7_A124 Structure Of A Transiently Phosphorylated "switch" 5e-05
1krw_A124 Solution Structure And Backbone Dynamics Of Beryllo 6e-05
3hzh_A157 Crystal Structure Of The Chex-Chey-Bef3-Mg+2 Comple 6e-05
1qkk_A155 Crystal Structure Of The Receiver Domain And Linker 6e-05
1dz3_A130 Domain-Swapping In The Sporulation Response Regulat 7e-05
3to5_A134 High Resolution Structure Of Chey3 From Vibrio Chol 1e-04
3dge_C122 Structure Of A Histidine Kinase-response Regulator 1e-04
1dc8_A124 Structure Of A Transiently Phosphorylated "switch" 1e-04
2jb9_A127 Phob Response Regulator Receiver Domain Constitutiv 1e-04
3t6k_A136 Crystal Structure Of A Hypothetical Response Regula 1e-04
3lua_A140 Crystal Structure Of A Signal Receiver Domain Of Tw 1e-04
1qmp_A130 Phosphorylated Aspartate In The Crystal Structure O 2e-04
3gl9_A122 The Structure Of A Histidine Kinase-Response Regula 2e-04
1dbw_A126 Crystal Structure Of Fixj-N Length = 126 2e-04
1zes_A125 Bef3- Activated Phob Receiver Domain Length = 125 3e-04
1b00_A127 Phob Receiver Domain From Escherichia Coli Length = 3e-04
3luf_A259 Structure Of Probable Two-Component System Response 4e-04
3i5a_A 334 Crystal Structure Of Full-Length Wpsr From Pseudomo 4e-04
3q15_C126 Crystal Structure Of Raph Complexed With Spo0f Leng 6e-04
1d5w_A126 Phosphorylated Fixj Receiver Domain Length = 126 7e-04
1srr_A124 Crystal Structure Of A Phosphatase Resistant Mutant 7e-04
1f51_E119 A Transient Interaction Between Two Phosphorelay Pr 7e-04
1pux_A124 Nmr Solution Structure Of Bef3-Activated Spo0f, 20 7e-04
2jvi_A132 Nmr Solution Structure Of The Hyper-Sporulation Res 8e-04
>pdb|3F7A|A Chain A, Structure Of Orthorhombic Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 Back     alignment and structure 
Iteration: 1

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 52/97 (53%), Gaps = 7/97 (7%)
Query: 3   VIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHD 62
           V+   NGLQ  +I E   +Q DLV+ ++  P + G+ L+R+I   +T    P+I++S   
Sbjct: 32  VLQALNGLQGLQIFES--EQPDLVICDLRXPQIDGLELIRRI--RQTASETPIIVLSGAG 87
Query: 63  SMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRKC 99
            MS   + L  GA  +L+KP+   E   + +H  R+ 
Sbjct: 88  VMSDAVEALRLGAADYLIKPL---EDLAVLEHSVRRA 121
>pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-digmp Length = 459 Back     alignment and structure
>pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 Back     alignment and structure
>pdb|3EQ2|A Chain A, Structure Of Hexagonal Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 Back     alignment and structure
>pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3H1F|A Chain A, Crystal Structure Of Chey Mutant D53a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3JTE|A Chain A, Crystal Structure Of Response Regulator Receiver Domain Protein From Clostridium Thermocellum Length = 143 Back     alignment and structure
>pdb|3GT7|A Chain A, Crystal Structure Of Signal Receiver Domain Of Signal Transduction Histidine Kinase From Syntrophus Aciditrophicus Length = 154 Back     alignment and structure
>pdb|1L5Y|A Chain A, Crystal Structure Of Mg2+ / Bef3-bound Receiver Domain Of Sinorhizobium Meliloti Dctd Length = 155 Back     alignment and structure
>pdb|1J56|A Chain A, Minimized Average Structure Of Beryllofluoride-Activated Ntrc Receiver Domain: Model Structure Incorporating Active Site Contacts Length = 124 Back     alignment and structure
>pdb|1DC7|A Chain A, Structure Of A Transiently Phosphorylated "switch" In Bacterial Signal Transduction Length = 124 Back     alignment and structure
>pdb|1KRW|A Chain A, Solution Structure And Backbone Dynamics Of Beryllofluoride- Activated Ntrc Receiver Domain Length = 124 Back     alignment and structure
>pdb|3HZH|A Chain A, Crystal Structure Of The Chex-Chey-Bef3-Mg+2 Complex From Borrelia Burgdorferi Length = 157 Back     alignment and structure
>pdb|1QKK|A Chain A, Crystal Structure Of The Receiver Domain And Linker Region Of Dctd From Sinorhizobium Meliloti Length = 155 Back     alignment and structure
>pdb|1DZ3|A Chain A, Domain-Swapping In The Sporulation Response Regulator Spo0a Length = 130 Back     alignment and structure
>pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 Back     alignment and structure
>pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>pdb|1DC8|A Chain A, Structure Of A Transiently Phosphorylated "switch" In Bacterial Signal Transduction Length = 124 Back     alignment and structure
>pdb|2JB9|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D10a And D53e. Length = 127 Back     alignment and structure
>pdb|3T6K|A Chain A, Crystal Structure Of A Hypothetical Response Regulator (Caur_3799) From Chloroflexus Aurantiacus J-10-Fl At 1.86 A Resolution Length = 136 Back     alignment and structure
>pdb|3LUA|A Chain A, Crystal Structure Of A Signal Receiver Domain Of Two Component Signal Transduction (Histidine Kinase) From Clostridium Thermocellum Length = 140 Back     alignment and structure
>pdb|1QMP|A Chain A, Phosphorylated Aspartate In The Crystal Structure Of The Sporulation Response Regulator, Spo0a Length = 130 Back     alignment and structure
>pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>pdb|1DBW|A Chain A, Crystal Structure Of Fixj-N Length = 126 Back     alignment and structure
>pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain Length = 125 Back     alignment and structure
>pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli Length = 127 Back     alignment and structure
>pdb|3LUF|A Chain A, Structure Of Probable Two-Component System Response RegulatorGGDEF DOMAIN PROTEIN Length = 259 Back     alignment and structure
>pdb|3I5A|A Chain A, Crystal Structure Of Full-Length Wpsr From Pseudomonas Syringae Length = 334 Back     alignment and structure
>pdb|3Q15|C Chain C, Crystal Structure Of Raph Complexed With Spo0f Length = 126 Back     alignment and structure
>pdb|1D5W|A Chain A, Phosphorylated Fixj Receiver Domain Length = 126 Back     alignment and structure
>pdb|1SRR|A Chain A, Crystal Structure Of A Phosphatase Resistant Mutant Of Sporulation Response Regulator Spo0f From Bacillus Subtilis Length = 124 Back     alignment and structure
>pdb|1F51|E Chain E, A Transient Interaction Between Two Phosphorelay Proteins Trapped In A Crystal Lattice Reveals The Mechanism Of Molecular Recognition And Phosphotransfer In Singal Transduction Length = 119 Back     alignment and structure
>pdb|1PUX|A Chain A, Nmr Solution Structure Of Bef3-Activated Spo0f, 20 Conformers Length = 124 Back     alignment and structure
>pdb|2JVI|A Chain A, Nmr Solution Structure Of The Hyper-Sporulation Response Regulator Spo0f Mutant H101a From Bacillus Subtilis Length = 132 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query162
3bre_A 358 Probable two-component response regulator; protein 2e-20
3luf_A259 Two-component system response regulator/ggdef doma 1e-19
3luf_A259 Two-component system response regulator/ggdef doma 2e-12
1w25_A 459 Stalked-cell differentiation controlling protein; 1e-18
1w25_A 459 Stalked-cell differentiation controlling protein; 2e-14
3hdg_A137 Uncharacterized protein; two-component sensor acti 1e-18
1srr_A124 SPO0F, sporulation response regulatory protein; as 8e-18
3cfy_A137 Putative LUXO repressor protein; structural genomi 2e-17
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 2e-17
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 3e-17
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 3e-17
3jte_A143 Response regulator receiver protein; structural ge 4e-17
2qxy_A142 Response regulator; regulation of transcription, N 9e-17
3cnb_A143 DNA-binding response regulator, MERR family; signa 1e-16
3eq2_A 394 Probable two-component response regulator; adaptor 1e-16
3hdv_A136 Response regulator; PSI-II, structural genomics, P 1e-16
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 2e-16
3lua_A140 Response regulator receiver protein; two-component 3e-16
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 3e-16
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 5e-16
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 5e-16
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 1e-15
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 1e-15
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 3e-15
3grc_A140 Sensor protein, kinase; protein structure initiati 4e-15
3heb_A152 Response regulator receiver domain protein (CHEY); 4e-15
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 4e-15
2rjn_A154 Response regulator receiver:metal-dependent phosph 6e-15
3i42_A127 Response regulator receiver domain protein (CHEY- 1e-14
3nhm_A133 Response regulator; protein structure initiative I 3e-14
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 4e-14
4dad_A146 Putative pilus assembly-related protein; response 6e-14
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 8e-14
3n53_A140 Response regulator receiver modulated diguanylate; 9e-14
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 1e-13
3crn_A132 Response regulator receiver domain protein, CHEY-; 2e-13
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 3e-13
2zay_A147 Response regulator receiver protein; structural ge 3e-13
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 3e-13
2rdm_A132 Response regulator receiver protein; structural ge 3e-13
1yio_A208 Response regulatory protein; transcription regulat 4e-13
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 6e-13
3gt7_A154 Sensor protein; structural genomics, signal receiv 7e-13
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 9e-13
3rqi_A184 Response regulator protein; structural genomics, s 3e-12
2qr3_A140 Two-component system response regulator; structura 3e-12
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 3e-12
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 3e-12
3c3m_A138 Response regulator receiver protein; structural ge 6e-12
1dz3_A130 Stage 0 sporulation protein A; response regulator, 7e-12
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 7e-12
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 1e-11
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 3e-11
3h5i_A140 Response regulator/sensory box protein/ggdef domai 4e-11
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 4e-11
3cg0_A140 Response regulator receiver modulated diguanylate 6e-11
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 9e-11
3snk_A135 Response regulator CHEY-like protein; P-loop conta 1e-10
1s8n_A205 Putative antiterminator; RV1626, structural genomi 1e-10
3cg4_A142 Response regulator receiver domain protein (CHEY-; 1e-10
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 2e-10
2qsj_A154 DNA-binding response regulator, LUXR family; struc 3e-10
3eqz_A135 Response regulator; structural genomics, unknown f 3e-10
1mb3_A124 Cell division response regulator DIVK; signal tran 3e-10
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 7e-10
3f6c_A134 Positive transcription regulator EVGA; structural 8e-10
3lte_A132 Response regulator; structural genomics, PSI, prot 2e-09
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 5e-09
1xhf_A123 DYE resistance, aerobic respiration control protei 2e-08
2gkg_A127 Response regulator homolog; social motility, recei 2e-08
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 2e-08
2ayx_A254 Sensor kinase protein RCSC; two independent struct 3e-08
3n0r_A286 Response regulator; sigma factor, receiver, two-co 3e-08
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 4e-08
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 5e-08
3r0j_A250 Possible two component system response transcript 6e-08
3a10_A116 Response regulator; phosphoacceptor, signaling pro 7e-08
3kto_A136 Response regulator receiver protein; PSI-II,struct 8e-08
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 2e-07
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 2e-07
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 2e-07
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 3e-07
2qv0_A143 Protein MRKE; structural genomics, transcription, 3e-07
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 4e-07
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 4e-07
3cz5_A153 Two-component response regulator, LUXR family; str 6e-07
1zgz_A122 Torcad operon transcriptional regulatory protein; 9e-07
1mvo_A136 PHOP response regulator; phosphate regulon, transc 1e-06
2gwr_A238 DNA-binding response regulator MTRA; two-component 3e-06
2oqr_A230 Sensory transduction protein REGX3; response regul 4e-06
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 4e-06
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 5e-06
3q9s_A249 DNA-binding response regulator; DNA binding protei 7e-06
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 9e-06
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 1e-05
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 2e-05
1ys7_A233 Transcriptional regulatory protein PRRA; response 2e-05
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 8e-05
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 2e-04
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 2e-04
3c3w_A225 Two component transcriptional regulatory protein; 2e-04
3eul_A152 Possible nitrate/nitrite response transcriptional 2e-04
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 3e-04
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 Back     alignment and structure
 Score = 85.2 bits (211), Expect = 2e-20
 Identities = 19/89 (21%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 1   MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSS 60
           +      +  QA  +      +  ++L +++MP + G+ LL     +   ++IP+I++S+
Sbjct: 44  IDFHFCSDPQQAVAVANQ--IKPTVILQDLVMPGVDGLTLLAAYRGNPATRDIPIIVLST 101

Query: 61  HDSMSIVFKCLSKGAVYFLVKPIRKNELQ 89
            +  ++     + GA  +LVK     EL 
Sbjct: 102 KEEPTVKSAAFAAGANDYLVKLPDAIELV 130
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Length = 225 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.93
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.88
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 99.87
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 99.85
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 99.83
3gt7_A154 Sensor protein; structural genomics, signal receiv 99.83
2lpm_A123 Two-component response regulator; transcription re 99.83
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 99.83
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 99.83
3luf_A259 Two-component system response regulator/ggdef doma 99.83
3crn_A132 Response regulator receiver domain protein, CHEY-; 99.83
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 99.83
3rqi_A184 Response regulator protein; structural genomics, s 99.82
3cfy_A137 Putative LUXO repressor protein; structural genomi 99.82
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 99.82
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 99.81
3nhm_A133 Response regulator; protein structure initiative I 99.81
1srr_A124 SPO0F, sporulation response regulatory protein; as 99.81
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 99.81
3heb_A152 Response regulator receiver domain protein (CHEY); 99.81
1zgz_A122 Torcad operon transcriptional regulatory protein; 99.81
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 99.81
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 99.81
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 99.81
1mb3_A124 Cell division response regulator DIVK; signal tran 99.81
3r0j_A250 Possible two component system response transcript 99.81
3n0r_A286 Response regulator; sigma factor, receiver, two-co 99.81
3kto_A136 Response regulator receiver protein; PSI-II,struct 99.81
3grc_A140 Sensor protein, kinase; protein structure initiati 99.81
3jte_A143 Response regulator receiver protein; structural ge 99.8
3hdg_A137 Uncharacterized protein; two-component sensor acti 99.8
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 99.8
2zay_A147 Response regulator receiver protein; structural ge 99.8
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 99.8
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 99.8
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 99.8
1xhf_A123 DYE resistance, aerobic respiration control protei 99.8
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 99.8
3cnb_A143 DNA-binding response regulator, MERR family; signa 99.8
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 99.8
3hdv_A136 Response regulator; PSI-II, structural genomics, P 99.79
3f6c_A134 Positive transcription regulator EVGA; structural 99.79
3c3m_A138 Response regulator receiver protein; structural ge 99.79
1mvo_A136 PHOP response regulator; phosphate regulon, transc 99.79
1dz3_A130 Stage 0 sporulation protein A; response regulator, 99.79
3i42_A127 Response regulator receiver domain protein (CHEY- 99.79
3lua_A140 Response regulator receiver protein; two-component 99.79
3n53_A140 Response regulator receiver modulated diguanylate; 99.79
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 99.79
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 99.78
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 99.78
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 99.78
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 99.78
3eul_A152 Possible nitrate/nitrite response transcriptional 99.78
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 99.78
2ayx_A254 Sensor kinase protein RCSC; two independent struct 99.78
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 99.78
2qxy_A142 Response regulator; regulation of transcription, N 99.78
3snk_A135 Response regulator CHEY-like protein; P-loop conta 99.78
3lte_A132 Response regulator; structural genomics, PSI, prot 99.77
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 99.77
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 99.77
3q9s_A249 DNA-binding response regulator; DNA binding protei 99.77
1w25_A 459 Stalked-cell differentiation controlling protein; 99.77
1yio_A208 Response regulatory protein; transcription regulat 99.77
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 99.77
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 99.77
2qr3_A140 Two-component system response regulator; structura 99.76
3cg4_A142 Response regulator receiver domain protein (CHEY-; 99.76
3bre_A 358 Probable two-component response regulator; protein 99.76
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 99.76
3cg0_A140 Response regulator receiver modulated diguanylate 99.76
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 99.76
2rjn_A154 Response regulator receiver:metal-dependent phosph 99.76
4dad_A146 Putative pilus assembly-related protein; response 99.76
3cz5_A153 Two-component response regulator, LUXR family; str 99.76
3a10_A116 Response regulator; phosphoacceptor, signaling pro 99.76
3eq2_A 394 Probable two-component response regulator; adaptor 99.75
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 99.75
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.75
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 99.75
1s8n_A205 Putative antiterminator; RV1626, structural genomi 99.75
3h5i_A140 Response regulator/sensory box protein/ggdef domai 99.74
1ys7_A233 Transcriptional regulatory protein PRRA; response 99.74
2gkg_A127 Response regulator homolog; social motility, recei 99.74
2qv0_A143 Protein MRKE; structural genomics, transcription, 99.73
3eqz_A135 Response regulator; structural genomics, unknown f 99.72
2oqr_A230 Sensory transduction protein REGX3; response regul 99.71
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 99.71
2rdm_A132 Response regulator receiver protein; structural ge 99.71
3c3w_A225 Two component transcriptional regulatory protein; 99.71
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 99.7
2gwr_A238 DNA-binding response regulator MTRA; two-component 99.7
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 99.7
2qsj_A154 DNA-binding response regulator, LUXR family; struc 99.7
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 99.69
3c97_A140 Signal transduction histidine kinase; structural g 99.69
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 99.69
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 99.69
3sy8_A 400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 99.68
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 99.68
2pln_A137 HP1043, response regulator; signaling protein; 1.8 99.66
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 99.63
2hqr_A223 Putative transcriptional regulator; phosporylation 99.63
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptat 99.61
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.6
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 99.57
3luf_A259 Two-component system response regulator/ggdef doma 99.53
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 99.51
1w25_A 459 Stalked-cell differentiation controlling protein; 99.26
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 97.84
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 97.52
3q7r_A121 Transcriptional regulatory protein; CHXR, receiver 97.02
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 95.12
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 95.05
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 94.39
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 94.12
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 94.08
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 93.89
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 93.85
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 93.76
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 93.43
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 92.99
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 92.84
2vws_A267 YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escher 92.65
1xrs_B262 D-lysine 5,6-aminomutase beta subunit; TIM barrel, 92.09
2v5j_A287 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; l 92.0
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 91.88
1ujp_A271 Tryptophan synthase alpha chain; riken structural 91.83
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 91.74
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 91.59
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II a 91.55
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 90.66
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 90.42
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 90.32
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 90.22
1req_A727 Methylmalonyl-COA mutase; isomerase, intramolecula 90.03
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 89.52
3kp1_A763 D-ornithine aminomutase E component; 5 aminomutase 89.48
2xij_A762 Methylmalonyl-COA mutase, mitochondrial; isomerase 89.24
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 89.17
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 88.84
1izc_A 339 Macrophomate synthase intermolecular diels-aldera; 88.62
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 88.32
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 88.19
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 88.1
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 87.94
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 87.88
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 87.73
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 87.47
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 87.39
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 87.26
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 87.11
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 87.02
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 86.85
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 86.65
3kts_A192 Glycerol uptake operon antiterminator regulatory; 86.5
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 86.12
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 85.77
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 85.04
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 84.71
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 84.57
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 84.56
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 84.51
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 84.45
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 84.12
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 84.08
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 83.92
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 83.83
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 83.64
1qv9_A283 F420-dependent methylenetetrahydromethanopterin de 83.37
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 83.3
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 82.81
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 82.75
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 82.71
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 82.53
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 82.52
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 82.45
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 82.36
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 82.24
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 81.93
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 81.65
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 81.47
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 80.84
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 80.53
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 80.35
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 80.22
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 80.18
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 80.12
1viz_A240 PCRB protein homolog; structural genomics, unknown 80.06
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
Probab=99.93  E-value=1.3e-25  Score=156.76  Aligned_cols=94  Identities=24%  Similarity=0.507  Sum_probs=88.7

Q ss_pred             EEEEcCHHHHHHHHHhhCCCccEEEEcCCCCCCCHHHHHHHHHccCCCCCCcEEEEecCCCHHHHHHHHHcCCceEEeCC
Q 044790            3 VIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLVKP   82 (162)
Q Consensus         3 v~~a~~~~eal~~l~~~~~~~DlvllD~~mp~~~g~~~~~~ir~~~~~~~~piI~lt~~~~~~~~~~a~~~Ga~~~l~KP   82 (162)
                      |..|.+|.+|++.+++  .+||+||+|+.||+|+|++++++||+....+++|||++|+....+...++++.|+++||.||
T Consensus        40 v~~a~~g~~al~~~~~--~~~DlillD~~MP~mdG~el~~~ir~~~~~~~ipvI~lTa~~~~~~~~~~~~~Ga~~yl~KP  117 (134)
T 3to5_A           40 TQEADDGLTALPMLKK--GDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKP  117 (134)
T ss_dssp             EEEESSHHHHHHHHHH--HCCSEEEEESCCSSSCHHHHHHHHHHSTTTTTCCEEEEESSCCHHHHHHHHHTTCCEEEESS
T ss_pred             EEEECCHHHHHHHHHh--CCCCEEEEcCCCCCCCHHHHHHHHHhCCCCCCCeEEEEECCCCHHHHHHHHHCCCCEEEECC
Confidence            6689999999999999  89999999999999999999999998777789999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHh
Q 044790           83 IRKNELQNLWQHVWRK   98 (162)
Q Consensus        83 ~~~~~L~~~i~~~l~~   98 (162)
                      |+.++|..+|++++++
T Consensus       118 ~~~~~L~~~i~~~l~R  133 (134)
T 3to5_A          118 FTAATLKEKLDKIFER  133 (134)
T ss_dssp             CCHHHHHHHHHHHCC-
T ss_pred             CCHHHHHHHHHHHHhc
Confidence            9999999999998754
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, 2-keto-3-deoxy SU aldolase, degradation of homoprotocatechuate; 1.39A {Escherichia coli} PDB: 2vwt_A Back     alignment and structure
>1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'-deoxyad radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1 Back     alignment and structure
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic DEGR aromatic hydrocarbons catabolism; 1.60A {Escherichia coli} PDB: 2v5k_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichii subspshermanii} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3kp1_A D-ornithine aminomutase E component; 5 aminomutase (OAM), metal binding protein; HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_A* 3koy_A* 3koz_A* 3kp0_A* 3kox_A* Back     alignment and structure
>2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1izc_A Macrophomate synthase intermolecular diels-aldera; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1qv9_A F420-dependent methylenetetrahydromethanopterin dehydrogenase; monomer: alpha/beta domain, helix bundle, trimer of dimers, oxidoreductase; HET: MSE; 1.54A {Methanopyrus kandleri} SCOP: c.127.1.1 PDB: 1u6i_A 1u6j_A 1u6k_A* 3iqe_A* 3iqf_A* 3iqz_A* Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 162
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 1e-18
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 3e-18
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 2e-17
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 2e-17
d1a2oa1140 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal 3e-16
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 7e-16
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 2e-15
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 3e-15
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 4e-15
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 6e-15
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 1e-14
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 2e-14
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 8e-14
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 1e-13
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 2e-13
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 2e-13
d2b4aa1118 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba 1e-12
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 1e-12
d1s8na_190 c.23.1.1 (A:) Probable two-component system transc 2e-12
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 3e-12
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 3e-12
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 1e-11
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 1e-11
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 3e-11
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 6e-11
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 1e-10
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 8e-10
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 8e-10
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 2e-09
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 3e-09
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 5e-09
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 2e-08
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 2e-08
d1qo0d_189 c.23.1.3 (D:) Positive regulator of the amidase op 8e-08
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: Sporulation response regulator Spo0A
species: Bacillus stearothermophilus [TaxId: 1422]

 Score = 74.5 bits (183), Expect = 1e-18
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 3   VIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHD 62
           +    NG    ++LE+   + D++L +++MP L G+ +L +I          VIM+++  
Sbjct: 30  IGTAYNGQDCLQMLEE--KRPDILLLDIIMPHLDGLAVLERIRAGFE-HQPNVIMLTAFG 86

Query: 63  SMSIVFKCLSKGAVYFLVKPIRKNELQNLWQHVWRK 98
              +  K +  GA YF++KP     L +  + V+ K
Sbjct: 87  QEDVTKKAVELGASYFILKPFDMENLAHHIRQVYGK 122
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query162
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.93
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.93
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.92
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.92
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.92
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.92
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.92
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.92
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.92
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.92
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.92
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.92
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.91
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.91
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.91
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.91
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.91
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.91
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.9
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.9
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.9
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.9
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.9
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.9
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.9
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.9
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.89
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.89
d1s8na_190 Probable two-component system transcriptional regu 99.89
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.89
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.88
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 99.82
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 99.8
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 99.74
d1xrsb1160 D-lysine 5,6-aminomutase beta subunit KamE, C-term 95.6
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 95.32
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 94.62
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 94.42
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 93.47
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 91.54
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 91.52
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 91.28
d1r8ja2135 N-terminal domain of the circadian clock protein K 91.1
d7reqb2163 Methylmalonyl-CoA mutase beta subunit, C-terminal 90.93
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 90.44
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 87.19
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 87.04
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 87.0
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 86.73
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 85.67
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 85.3
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 84.35
d1u6ka1282 F420-dependent methylenetetrahydromethanopterin de 84.2
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 83.82
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 83.63
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 83.23
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 81.73
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 81.19
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 80.39
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: PhoP receiver domain
species: Escherichia coli [TaxId: 562]

Probab=99.93  E-value=2.4e-25  Score=150.70  Aligned_cols=94  Identities=21%  Similarity=0.361  Sum_probs=90.6

Q ss_pred             CEEEEEcCHHHHHHHHHhhCCCccEEEEcCCCCCCCHHHHHHHHHccCCCCCCcEEEEecCCCHHHHHHHHHcCCceEEe
Q 044790            1 MAVIAVENGLQAWKILEDLMDQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLV   80 (162)
Q Consensus         1 ~~v~~a~~~~eal~~l~~~~~~~DlvllD~~mp~~~g~~~~~~ir~~~~~~~~piI~lt~~~~~~~~~~a~~~Ga~~~l~   80 (162)
                      |+|..+.++.+|++.+++  ..||+||+|+.||+++|++++++||+..  +.+|||++|+..+.+...++++.||++||.
T Consensus        25 ~~v~~a~~g~eal~~l~~--~~~dliilD~~mP~~~G~e~~~~i~~~~--~~~pvi~lt~~~~~~~~~~a~~~Ga~~yl~  100 (119)
T d2pl1a1          25 HQVDDAEDAKEADYYLNE--HIPDIAIVDLGLPDEDGLSLIRRWRSND--VSLPILVLTARESWQDKVEVLSAGADDYVT  100 (119)
T ss_dssp             CEEEEESSHHHHHHHHHH--SCCSEEEECSCCSSSCHHHHHHHHHHTT--CCSCEEEEESCCCHHHHHHHHHTTCSEEEE
T ss_pred             CEEEEECCHHHHHHHHHh--cccceeehhccCCCchhHHHHHHHHhcC--cccceEeeeccCCHHHHHHHHHcCCCEEEE
Confidence            789999999999999999  8999999999999999999999999876  789999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHh
Q 044790           81 KPIRKNELQNLWQHVWRK   98 (162)
Q Consensus        81 KP~~~~~L~~~i~~~l~~   98 (162)
                      ||++.++|..+|+.++++
T Consensus       101 KP~~~~~L~~~v~~~lrR  118 (119)
T d2pl1a1         101 KPFHIEEVMARMQALMRR  118 (119)
T ss_dssp             SSCCHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHcc
Confidence            999999999999999875
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r8ja2 c.23.1.5 (A:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1u6ka1 c.127.1.1 (A:2-283) F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure