Citrus Sinensis ID: 044836


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MINISQYILETTVYPREHECLKELRELTEKHPQNFMFSAPDEAQFLSMLLKLINAKNTMEIGVYTGYSLLVTALAIPDDGKVQWMNTNLY
cccHHHHHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccccEEEEEEcccc
MINISQYILETTVYPREHECLKELRELTEKHPQNFMFSAPDEAQFLSMLLKLINAKNTMEIGVYTGYSLLVTALAIPDDGKVQWMNTNLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINISQYILETTVYPREHECLKELRELTEKHPQNFMFSAPDEAQFLSMLLKLINAKNTMEIGVYTGYSLLVTALAIPDDGKVQWMNTNLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Caffeoyl-CoA O-methyltransferase Methylates caffeoyl-CoA to feruloyl-CoA and 5-hydroxyferuloyl-CoA to sinapoyl-CoA. Plays a role in the synthesis of feruloylated polysaccharides. Involved in the reinforcement of the plant cell wall. Also involved in the responding to wounding or pathogen challenge by the increased formation of cell wall-bound ferulic acid polymers.probableQ43237
Caffeoyl-CoA O-methyltransferase 2 Methylates caffeoyl-CoA to feruloyl-CoA and 5-hydroxyferuloyl-CoA to sinapoyl-CoA. Plays a role in the synthesis of feruloylated polysaccharides. Involved in the reinforcement of the plant cell wall. Also involved in the responding to wounding or pathogen challenge by the increased formation of cell wall-bound ferulic acid polymers.probableO65922

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SUI, chain A
Confidence level:very confident
Coverage over the Query: 2-89
View the alignment between query and template
View the model in PyMOL