Citrus Sinensis ID: 044864


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MRKPCCDKQDTNKGAWSKQEDQKLIDYIRKHGEGCWRTIPQAAGLARCGKSCRLRWINYLRPDLKRGNFAEDEEDLIIKLHALLGNRWSLIAGRLPGRTANEVKNYWNSHLRRKLINMGIDPKNHRLHHSLPHNSTGATSLGQQLVDMNEPAVKPRGDDIYQASDAGSCWEDEPCRLLPDLNLDLTMSIPSSSSSPSLANKANTEKKNDSELPN
cccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHcccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**KPCCD****NKGAWSKQEDQKLIDYIRKHGEGCWRTIPQAAGLARCGKSCRLRWINYLRPDLKRGNFAEDEEDLIIKLHALLGNRWSLIAGRLPGRTANEVKNYWNSHLRRKLINMGID********************************************************LPDLNLDLT****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKPCCDKQDTNKGAWSKQEDQKLIDYIRKHGEGCWRTIPQAAGLARCGKSCRLRWINYLRPDLKRGNFAEDEEDLIIKLHALLGNRWSLIAGRLPGRTANEVKNYWNSHLRRKLINMGIDPKNHRLHHSLPHNSTGATSLGQQLVDMNEPAVKPRGDDIYQASDAGSCWEDEPCRLLPDLNLDLTMSIPSSSSSPSLANKANTEKKNDSELPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription repressor MYB4 Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate.probableQ9SZP1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H8A, chain C
Confidence level:very confident
Coverage over the Query: 8-113
View the alignment between query and template
View the model in PyMOL
Template: 1H89, chain C
Confidence level:very confident
Coverage over the Query: 51-160
View the alignment between query and template
View the model in PyMOL