Citrus Sinensis ID: 044904

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----

RPKTLRPRTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD

ccccccccEEEEccccccccHHHHHHHHcccccccccccEEECccccccccHHHHHHHHHHcccccccEEEEEcccccccccccEEEccccccccCEEEEEEccccccccccEEEcccccccEEEcccccccEEEEccCEEEEEEcccEEEEEcc

*****RPRTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

RPKTLRPRTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
10 kDa chaperonin	Seems to function only as a co-chaperone, along with cpn60, and in certain cases is essential for the discharge of biologically active proteins from cpn60.	probable	Q96539

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WE3, chain O
Confidence level:very confident
Coverage over the Query: 61-154
View the alignment between query and template
View the model in PyMOL