Citrus Sinensis ID: 044904

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
RPKTLRPRTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD
ccccccccEEEEcccccccHHHHHHHHHcccccccccccEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccccccccccEEEccccccccEEEEEEEccccccccccEEEcccccccEEEcccccccEEEEccEEEEEEEcccEEEEEcc
ccccccccEEEEcHHHccHcHHHHHHHHHcccccccccEEEEcEEccccccHHHHcccHHEEEcccccEEEEEEEcccccccccEEEccccccccccEEEEEccccccccccEEEEEEEcccEEEEEEccccEEEEcccEEEEEEHHHHEEEEcc
rpktlrprtfylypelinpsNLLILLYISrsraspvspvilqwqhcpkgpnfcrESKAMAKRLIPTLNRVLVekivppsktnagillpekssklnsgkviavgpgardkegntipvafkegdtvllpnyggdhvklgekdyhlyrdeeilgtlhd
rpktlrprtfylypelinPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKivppsktnagillpekssklnsgKVIAVgpgardkegnTIPVafkegdtvllpnYGGDHVKLGEKDYHLYRDEeilgtlhd
RPKTLRPRTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD
*******RTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPP****AGIL*************IA**********NTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEIL*****
*****RP*TFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKG*NF*RE*KAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD
RPKTLRPRTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD
***TLRPRTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RPKTLRPRTFYLYPELINPSNLLILLYISRSRASPVSPVILQWQHCPKGPNFCRESKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
P3489398 10 kDa chaperonin OS=Arab no no 0.625 0.989 0.731 1e-37
Q9653998 10 kDa chaperonin OS=Bras N/A no 0.625 0.989 0.731 2e-37
O59804104 10 kDa heat shock protein yes no 0.619 0.923 0.484 9e-20
Q9W6X399 10 kDa heat shock protein N/A no 0.612 0.959 0.458 2e-18
P38910106 10 kDa heat shock protein yes no 0.606 0.886 0.468 4e-17
Q5DC69102 10 kDa heat shock protein N/A no 0.606 0.921 0.378 2e-14
Q64433102 10 kDa heat shock protein yes no 0.612 0.931 0.479 4e-14
P26772102 10 kDa heat shock protein yes no 0.612 0.931 0.479 7e-14
P61604102 10 kDa heat shock protein yes no 0.612 0.931 0.479 7e-14
P61603102 10 kDa heat shock protein yes no 0.612 0.931 0.479 7e-14
>sp|P34893|CH10_ARATH 10 kDa chaperonin OS=Arabidopsis thaliana GN=CPN10 PE=3 SV=1 Back     alignment and function desciption
 Score =  155 bits (391), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 86/97 (88%)

Query: 59  MAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAF 118
           M KRLIPT NR+LV++++ P+KT +GILLPEKSSKLNSGKVIAVGPG+RDK+G  IPV+ 
Sbjct: 1   MMKRLIPTFNRILVQRVIQPAKTESGILLPEKSSKLNSGKVIAVGPGSRDKDGKLIPVSV 60

Query: 119 KEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD 155
           KEGDTVLLP YGG  VKLGE +YHL+RDE++LGTLH+
Sbjct: 61  KEGDTVLLPEYGGTQVKLGENEYHLFRDEDVLGTLHE 97
Seems to function only as a co-chaperone, along with cpn60, and in certain cases is essential for the discharge of biologically active proteins from cpn60.
Arabidopsis thaliana (taxid: 3702)
>sp|Q96539|CH10_BRANA 10 kDa chaperonin OS=Brassica napus PE=3 SV=1 Back     alignment and function description
>sp|O59804|CH10_SCHPO 10 kDa heat shock protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp10 PE=1 SV=1 Back     alignment and function description
>sp|Q9W6X3|CH10_ORYLA 10 kDa heat shock protein, mitochondrial OS=Oryzias latipes GN=hspe1 PE=3 SV=1 Back     alignment and function description
>sp|P38910|CH10_YEAST 10 kDa heat shock protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP10 PE=1 SV=1 Back     alignment and function description
>sp|Q5DC69|CH10_SCHJA 10 kDa heat shock protein, mitochondrial OS=Schistosoma japonicum GN=SJCHGC01960 PE=3 SV=2 Back     alignment and function description
>sp|Q64433|CH10_MOUSE 10 kDa heat shock protein, mitochondrial OS=Mus musculus GN=Hspe1 PE=1 SV=2 Back     alignment and function description
>sp|P26772|CH10_RAT 10 kDa heat shock protein, mitochondrial OS=Rattus norvegicus GN=Hspe1 PE=1 SV=3 Back     alignment and function description
>sp|P61604|CH10_HUMAN 10 kDa heat shock protein, mitochondrial OS=Homo sapiens GN=HSPE1 PE=1 SV=2 Back     alignment and function description
>sp|P61603|CH10_BOVIN 10 kDa heat shock protein, mitochondrial OS=Bos taurus GN=HSPE1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
22543587897 PREDICTED: 10 kDa chaperonin [Vitis vini 0.625 1.0 0.783 9e-39
22405969097 predicted protein [Populus trichocarpa] 0.625 1.0 0.804 9e-39
44946576598 PREDICTED: 10 kDa chaperonin-like isofor 0.625 0.989 0.814 1e-38
22542424297 PREDICTED: 10 kDa chaperonin [Vitis vini 0.625 1.0 0.814 3e-38
22409949197 predicted protein [Populus trichocarpa] 0.625 1.0 0.814 2e-37
44945315797 PREDICTED: 10 kDa chaperonin-like [Cucum 0.625 1.0 0.773 2e-37
22411150097 predicted protein [Populus trichocarpa] 0.625 1.0 0.824 2e-37
22544010997 PREDICTED: 10 kDa chaperonin [Vitis vini 0.625 1.0 0.793 2e-37
12562017697 small molecular heat shock protein 10 [N 0.625 1.0 0.773 4e-37
29784534697 hypothetical protein ARALYDRAFT_472563 [ 0.625 1.0 0.793 4e-37
>gi|225435878|ref|XP_002264840.1| PREDICTED: 10 kDa chaperonin [Vitis vinifera] gi|296083899|emb|CBI24287.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  164 bits (416), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 92/97 (94%)

Query: 59  MAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAF 118
           MAKRLIPTLNR+LVEKIVPPSKTNAGILLPEK+++LNSGKV+AVGPGARD++G  IP++ 
Sbjct: 1   MAKRLIPTLNRILVEKIVPPSKTNAGILLPEKTAQLNSGKVVAVGPGARDRDGKLIPLSV 60

Query: 119 KEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD 155
           +EGDTVLLP YGG+ VKLG+K+YHL+RD++ILGTLHD
Sbjct: 61  REGDTVLLPEYGGNQVKLGDKEYHLFRDDDILGTLHD 97

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224059690|ref|XP_002299972.1| predicted protein [Populus trichocarpa] gi|222847230|gb|EEE84777.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449465765|ref|XP_004150598.1| PREDICTED: 10 kDa chaperonin-like isoform 1 [Cucumis sativus] gi|449465767|ref|XP_004150599.1| PREDICTED: 10 kDa chaperonin-like isoform 2 [Cucumis sativus] gi|449514630|ref|XP_004164433.1| PREDICTED: 10 kDa chaperonin-like isoform 1 [Cucumis sativus] gi|449514632|ref|XP_004164434.1| PREDICTED: 10 kDa chaperonin-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225424242|ref|XP_002284449.1| PREDICTED: 10 kDa chaperonin [Vitis vinifera] gi|147801554|emb|CAN77010.1| hypothetical protein VITISV_036880 [Vitis vinifera] gi|297737695|emb|CBI26896.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224099491|ref|XP_002311504.1| predicted protein [Populus trichocarpa] gi|222851324|gb|EEE88871.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449453157|ref|XP_004144325.1| PREDICTED: 10 kDa chaperonin-like [Cucumis sativus] gi|449488243|ref|XP_004157979.1| PREDICTED: 10 kDa chaperonin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224111500|ref|XP_002315880.1| predicted protein [Populus trichocarpa] gi|222864920|gb|EEF02051.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225440109|ref|XP_002282838.1| PREDICTED: 10 kDa chaperonin [Vitis vinifera] gi|297741661|emb|CBI32793.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|125620176|gb|ABN46980.1| small molecular heat shock protein 10 [Nelumbo nucifera] Back     alignment and taxonomy information
>gi|297845346|ref|XP_002890554.1| hypothetical protein ARALYDRAFT_472563 [Arabidopsis lyrata subsp. lyrata] gi|297336396|gb|EFH66813.1| hypothetical protein ARALYDRAFT_472563 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
TAIR|locus:219618998 CPN10 "chaperonin 10" [Arabido 0.625 0.989 0.731 1.7e-36
TAIR|locus:220121097 AT1G23100 [Arabidopsis thalian 0.625 1.0 0.773 3.5e-36
UNIPROTKB|G4N561104 MGG_13221 "Hsp10-like protein" 0.612 0.913 0.531 1.3e-22
ASPGD|ASPL0000049286103 AN2432 [Emericella nidulans (t 0.612 0.922 0.510 3.4e-22
POMBASE|SPCC550.06c104 hsp10 "mitochondrial heat shoc 0.619 0.923 0.484 2.1e-20
ZFIN|ZDB-GENE-000906-2100 hspe1 "heat shock 10 protein 1 0.612 0.95 0.479 7.2e-20
GENEDB_PFALCIPARUM|PFL0740c103 PFL0740c "10 kd chaperonin, pu 0.645 0.970 0.405 2.5e-19
UNIPROTKB|Q8I5Q3103 Cpn10 "10 kd chaperonin" [Plas 0.645 0.970 0.405 2.5e-19
UNIPROTKB|F1NGP9101 HSPE1 "Uncharacterized protein 0.612 0.940 0.458 2.8e-18
UNIPROTKB|O42283102 HSPE1 "Uncharacterized protein 0.612 0.931 0.458 2.8e-18
TAIR|locus:2196189 CPN10 "chaperonin 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 393 (143.4 bits), Expect = 1.7e-36, P = 1.7e-36
 Identities = 71/97 (73%), Positives = 86/97 (88%)

Query:    59 MAKRLIPTLNRVLVEKIVPPSKTNAGILLPEKSSKLNSGKVIAVGPGARDKEGNTIPVAF 118
             M KRLIPT NR+LV++++ P+KT +GILLPEKSSKLNSGKVIAVGPG+RDK+G  IPV+ 
Sbjct:     1 MMKRLIPTFNRILVQRVIQPAKTESGILLPEKSSKLNSGKVIAVGPGSRDKDGKLIPVSV 60

Query:   119 KEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTLHD 155
             KEGDTVLLP YGG  VKLGE +YHL+RDE++LGTLH+
Sbjct:    61 KEGDTVLLPEYGGTQVKLGENEYHLFRDEDVLGTLHE 97
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006457 "protein folding" evidence=IEA;IGI;RCA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0051087 "chaperone binding" evidence=ISS
TAIR|locus:2201210 AT1G23100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N561 MGG_13221 "Hsp10-like protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000049286 AN2432 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPCC550.06c hsp10 "mitochondrial heat shock protein Hsp10 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000906-2 hspe1 "heat shock 10 protein 1 (chaperonin 10)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL0740c PFL0740c "10 kd chaperonin, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I5Q3 Cpn10 "10 kd chaperonin" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGP9 HSPE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O42283 HSPE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96539CH10_BRANANo assigned EC number0.73190.62580.9897N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
smart0088393 smart00883, Cpn10, Chaperonin 10 Kd subunit 7e-32
cd0032093 cd00320, cpn10, Chaperonin 10 Kd subunit (cpn10 or 1e-31
pfam0016691 pfam00166, Cpn10, Chaperonin 10 Kd subunit 2e-25
COG023496 COG0234, GroS, Co-chaperonin GroES (HSP10) [Posttr 1e-24
PRK0036495 PRK00364, groES, co-chaperonin GroES; Reviewed 2e-21
PTZ00414100 PTZ00414, PTZ00414, 10 kDa heat shock protein; Pro 2e-17
PRK1453391 PRK14533, groES, co-chaperonin GroES; Provisional 9e-07
>gnl|CDD|197951 smart00883, Cpn10, Chaperonin 10 Kd subunit Back     alignment and domain information 
 Score =  109 bits (274), Expect = 7e-32
 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 1/93 (1%)

Query: 62  RLIPTLNRVLVEKIVPPSKTNAGILLPEKS-SKLNSGKVIAVGPGARDKEGNTIPVAFKE 120
           ++ P  +RVLV++I    KT  GI++P+ +  K   G+V+AVGPG R + G  +P+  K 
Sbjct: 1   KIKPLGDRVLVKRIEEEEKTAGGIVIPDTAKEKPQEGEVVAVGPGKRLENGERVPLDVKV 60

Query: 121 GDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTL 153
           GD VL   Y G  VKL  ++Y + R+ +IL  +
Sbjct: 61  GDKVLFGKYAGTEVKLDGEEYLILRESDILAVI 93

The chaperonins are 'helper' molecules required for correct folding and subsequent assembly of some proteins. These are required for normal cell growth, and are stress-induced, acting to stabilise or protect disassembled polypeptides under heat-shock conditions. Type I chaperonins present in eubacteria, mitochondria and chloroplasts require the concerted action of 2 proteins, chaperonin 60 (cpn60) and chaperonin 10 (cpn10). The 10 kDa chaperonin (cpn10 - or groES in bacteria) exists as a ring-shaped oligomer of between six to eight identical subunits, while the 60 kDa chaperonin (cpn60 - or groEL in bacteria) forms a structure comprising 2 stacked rings, each ring containing 7 identical subunits. These ring structures assemble by self-stimulation in the presence of Mg2+-ATP. The central cavity of the cylindrical cpn60 tetradecamer provides as isolated environment for protein folding whilst cpn-10 binds to cpn-60 and synchronizes the release of the folded protein in an Mg2+-ATP dependent manner. The binding of cpn10 to cpn60 inhibits the weak ATPase activity of cpn60. Length = 93
>gnl|CDD|238197 cd00320, cpn10, Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information
>gnl|CDD|201050 pfam00166, Cpn10, Chaperonin 10 Kd subunit Back     alignment and domain information
>gnl|CDD|223312 COG0234, GroS, Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178988 PRK00364, groES, co-chaperonin GroES; Reviewed Back     alignment and domain information
>gnl|CDD|173604 PTZ00414, PTZ00414, 10 kDa heat shock protein; Provisional Back     alignment and domain information
>gnl|CDD|184730 PRK14533, groES, co-chaperonin GroES; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
COG023496 GroS Co-chaperonin GroES (HSP10) [Posttranslationa 100.0
PRK0036495 groES co-chaperonin GroES; Reviewed 100.0
cd0032093 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); C 100.0
PRK1453391 groES co-chaperonin GroES; Provisional 100.0
PTZ00414100 10 kDa heat shock protein; Provisional 100.0
PF0016693 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR0208 100.0
KOG1641104 consensus Mitochondrial chaperonin [Posttranslatio 99.96
KOG1197 336 consensus Predicted quinone oxidoreductase [Energy 90.94
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 90.28
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 86.5
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 82.67
KOG0025 354 consensus Zn2+-binding dehydrogenase (nuclear rece 80.22
>COG0234 GroS Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-37  Score=229.24  Aligned_cols=95  Identities=37%  Similarity=0.718  Sum_probs=91.9

Q ss_pred             ccceecCCeEEEEecCCCCcccceEEecCC-CCCceeeEEEEEcCCccCCCCceeeeeeecCCEEEecCCCceEEEECCE
Q 044904           61 KRLIPTLNRVLVEKIVPPSKTNAGILLPEK-SSKLNSGKVIAVGPGARDKEGNTIPVAFKEGDTVLLPNYGGDHVKLGEK  139 (155)
Q Consensus        61 ~~i~PLgDRVLVk~~e~e~kT~gGIiLP~s-a~k~~~G~VVAVG~G~~~~~G~~~P~~VKvGD~Vlf~~y~G~evk~dg~  139 (155)
                      ++|+||||||||++.++|++|+|||+||++ ++|++.|+|||||+|..+++|+++|++||+||+|+|++|+|+++++||+
T Consensus         1 m~ikPL~DRVlVk~~e~EekT~gGIvlpdsakeK~~~g~VvAVG~G~~~~~g~~~~~~VkvGD~Vlf~ky~G~evk~dge   80 (96)
T COG0234           1 MKIKPLGDRVLVKRVEEEEKTAGGIVLPDSAKEKPQEGEVVAVGPGRRDENGELVPLDVKVGDRVLFGKYAGTEVKIDGE   80 (96)
T ss_pred             CCceecCCEEEEEEchhhccccCcEEecCccccCCcceEEEEEccceecCCCCEeccccccCCEEEECccCCcEEEECCE
Confidence            379999999999999999999999999999 4799999999999999999999999999999999999999999999999


Q ss_pred             EEEEEecCceEEEecC
Q 044904          140 DYHLYRDEEILGTLHD  155 (155)
Q Consensus       140 ey~ivre~DILAvi~~  155 (155)
                      +|++++++||||++++
T Consensus        81 eylil~e~DILAiv~~   96 (96)
T COG0234          81 EYLILSESDILAIVEK   96 (96)
T ss_pred             EEEEechHHeeEEecC
Confidence            9999999999999974

>PRK00364 groES co-chaperonin GroES; Reviewed Back     alignment and domain information
>cd00320 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information
>PRK14533 groES co-chaperonin GroES; Provisional Back     alignment and domain information
>PTZ00414 10 kDa heat shock protein; Provisional Back     alignment and domain information
>PF00166 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR020818 The chaperonins are `helper' molecules required for correct folding and subsequent assembly of some proteins [] Back     alignment and domain information
>KOG1641 consensus Mitochondrial chaperonin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
1wnr_A94 Crystal Structure Of The Cpn10 From Thermus Thermop 2e-10
1we3_O100 Crystal Structure Of The Chaperonin Complex Cpn60CP 2e-10
1hx5_A99 Crystal Structure Of M. Tuberculosis Chaperonin-10 4e-08
1lep_A99 Three-Dimensional Structure Of The Immunodominant H 5e-08
3nx6_A95 Crystal Structure Of Co-Chaperonin, Groes (Xoo4289) 6e-04
>pdb|1WNR|A Chain A, Crystal Structure Of The Cpn10 From Thermus Thermophilus Hb8 Length = 94 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
Query: 65  PTLNRVLVEKIVPPSKTNAGILLPEKS-SKLNSGKVIAVGPGARDKEGNTIPVAFKEGDT 123
           P  +RV+V++I    KT  GI+LP+ +  K   GKVIAVG G   + G  +P+  KEGD 
Sbjct: 4   PLGDRVVVKRIEEEPKTKGGIVLPDTAKEKPQKGKVIAVGTGRVLENGQRVPLEVKEGDI 63
Query: 124 VLLPNYGGDHVKLGEKDYHLYRDEEILGTLH 154
           V+   YGG  +++  ++Y +  + ++L  L 
Sbjct: 64  VVFAKYGGTEIEIDGEEYVILSERDLLAVLQ 94
>pdb|1WE3|O Chain O, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 100 Back     alignment and structure
>pdb|1HX5|A Chain A, Crystal Structure Of M. Tuberculosis Chaperonin-10 Length = 99 Back     alignment and structure
>pdb|1LEP|A Chain A, Three-Dimensional Structure Of The Immunodominant Heat- Shock Protein Chaperonin-10 Of Mycobacterium Leprae Length = 99 Back     alignment and structure
>pdb|3NX6|A Chain A, Crystal Structure Of Co-Chaperonin, Groes (Xoo4289) From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 95 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, 1e-21
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes 2e-20
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escheri 2e-19
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, fl 1e-18
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Length = 100 Back     alignment and structure
 Score = 82.6 bits (205), Expect = 1e-21
 Identities = 35/102 (34%), Positives = 56/102 (54%), Gaps = 7/102 (6%)

Query: 56  SKAMAKRLIPTLNRVLVEKIVPPSKTNAGILLP----EKSSKLNSGKVIAVGPGARDKEG 111
           +  +   + P  +RV+V++I    KT  GI+LP    EK  K   GKVIAVG G   + G
Sbjct: 1   AAEVKTVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAKEKPQK---GKVIAVGTGRVLENG 57

Query: 112 NTIPVAFKEGDTVLLPNYGGDHVKLGEKDYHLYRDEEILGTL 153
             +P+  KEGD V+   YGG  +++  ++Y +  + ++L  L
Sbjct: 58  QRVPLEVKEGDIVVFAKYGGTEIEIDGEEYVILSERDLLAVL 99
>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} Length = 95 Back     alignment and structure
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Length = 97 Back     alignment and structure
>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, fl 100.0
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes 100.0
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, 100.0
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escheri 100.0
1g31_A111 GP31; chaperone, CO-chaperonin, groes, in VIVO pro 99.93
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 89.76
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 88.31
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 87.86
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 87.56
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 87.49
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 87.32
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 87.15
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 86.71
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 86.49
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 85.92
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 85.41
3gms_A 340 Putative NADPH:quinone reductase; structural genom 85.29
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 84.96
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 84.55
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 84.46
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 84.42
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 84.26
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 83.9
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 83.79
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 83.73
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 83.34
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 83.12
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 82.74
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 82.69
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 82.34
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 81.76
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 81.65
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 81.58
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 81.57
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 81.35
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 81.17
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 80.8
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 80.65
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 80.62
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 80.58
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 80.51
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 80.48
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 80.35
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 80.17
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 80.13
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 80.05
>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Back     alignment and structure
Probab=100.00  E-value=1.6e-38  Score=234.12  Aligned_cols=95  Identities=31%  Similarity=0.664  Sum_probs=91.8

Q ss_pred             ccceecCCeEEEEecCCCCcccceEEecCC-CCCceeeEEEEEcCCccCCCC-ceeeeeeecCCEEEecCCCceEEEECC
Q 044904           61 KRLIPTLNRVLVEKIVPPSKTNAGILLPEK-SSKLNSGKVIAVGPGARDKEG-NTIPVAFKEGDTVLLPNYGGDHVKLGE  138 (155)
Q Consensus        61 ~~i~PLgDRVLVk~~e~e~kT~gGIiLP~s-a~k~~~G~VVAVG~G~~~~~G-~~~P~~VKvGD~Vlf~~y~G~evk~dg  138 (155)
                      ++|+||+|||||++.++|++|+|||+||++ ++|+++|+|||||+|+++++| +++|++||+||+|+|++|+|++|++||
T Consensus         3 ~~i~PL~DRVlVk~~e~e~kT~gGI~LP~sakeKp~~G~VvAVG~G~~~~~G~~~~p~~VkvGD~Vlf~ky~Gtevk~dg   82 (99)
T 1p3h_A            3 VNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNG   82 (99)
T ss_dssp             CEEEECTTEEEEEECCCCCBCTTSCBCCCSSCCSEEEEEEEEECCCEECSSSSCEECCSCCTTCEEEEECTTCEEEEETT
T ss_pred             ceeEEeCCEEEEEEccccccccceEEeCcccccCCceEEEEEECCCcCcCCCCEEEccccCCCCEEEECCcCCeEEEECC
Confidence            489999999999999999999999999999 579999999999999999999 999999999999999999999999999


Q ss_pred             EEEEEEecCceEEEecC
Q 044904          139 KDYHLYRDEEILGTLHD  155 (155)
Q Consensus       139 ~ey~ivre~DILAvi~~  155 (155)
                      ++|+++|++||||++++
T Consensus        83 eey~i~re~DIlavi~~   99 (99)
T 1p3h_A           83 EEYLILSARDVLAVVSK   99 (99)
T ss_dssp             EEEEEEEGGGEEEEEEC
T ss_pred             EEEEEEEhHhEEEEeeC
Confidence            99999999999999975
>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} SCOP: b.35.1.0 Back     alignment and structure
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Back     alignment and structure
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Back     alignment and structure
>1g31_A GP31; chaperone, CO-chaperonin, groes, in VIVO protein folding, bacteriophage T4; 2.30A {Enterobacteria phage T4} SCOP: b.35.1.1 PDB: 2cgt_O Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 155
d1aono_97 b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia c 1e-23
d1p3ha_99 b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium 7e-23
d1we3o_96 b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus therm 6e-20
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Escherichia coli [TaxId: 562]

 Score = 86.4 bits (214), Expect = 1e-23
 Identities = 26/93 (27%), Positives = 48/93 (51%), Gaps = 2/93 (2%)

Query: 63  LIPTLNRVLVEKIVPPSKTNAGILLPEKSS-KLNSGKVIAVGPGARDKEGNTIPVAFKEG 121
           + P  +RV+V++    +K+  GI+L   ++ K   G+V+AVG G   + G   P+  K G
Sbjct: 3   IRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEVLAVGNGRILENGEVKPLDVKVG 62

Query: 122 DTVLLP-NYGGDHVKLGEKDYHLYRDEEILGTL 153
           D V+    YG    K+  ++  +  + +IL  +
Sbjct: 63  DIVIFNDGYGVKSEKIDNEEVLIMSESDILAIV 95
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure
>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Length = 96 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
d1p3ha_99 Chaperonin-10 (GroES) {Mycobacterium tuberculosis 100.0
d1aono_97 Chaperonin-10 (GroES) {Escherichia coli [TaxId: 56 99.98
d1we3o_96 Chaperonin-10 (GroES) {Thermus thermophilus [TaxId 99.98
d1g31a_107 GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665 97.26
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.87
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.54
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 88.86
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 88.69
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 88.54
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 87.74
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 87.67
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 85.86
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 85.45
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 85.4
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 83.68
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 83.17
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 81.77
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 81.65
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 81.14
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=3.5e-33  Score=201.77  Aligned_cols=95  Identities=31%  Similarity=0.664  Sum_probs=89.4

Q ss_pred             ccceecCCeEEEEecCCCCcccceEEecCC-CCCceeeEEEEEcCCccCCCC-ceeeeeeecCCEEEecCCCceEEEECC
Q 044904           61 KRLIPTLNRVLVEKIVPPSKTNAGILLPEK-SSKLNSGKVIAVGPGARDKEG-NTIPVAFKEGDTVLLPNYGGDHVKLGE  138 (155)
Q Consensus        61 ~~i~PLgDRVLVk~~e~e~kT~gGIiLP~s-a~k~~~G~VVAVG~G~~~~~G-~~~P~~VKvGD~Vlf~~y~G~evk~dg  138 (155)
                      ++|+||+|||||++.+.+++|+|||+||++ ++++..|+|||||+|..+.+| ...|+.||+||+|+|++|+|++|++||
T Consensus         3 m~ikPlgdrVLVk~~~~~~kT~gGIiLp~~~~~~~~~G~VvavG~g~~~~~~~~~~~~~vk~GD~Vl~~~~~g~~v~~dg   82 (99)
T d1p3ha_           3 VNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNG   82 (99)
T ss_dssp             CEEEECTTEEEEEECCCCCBCTTSCBCCCSSCCSEEEEEEEEECCCEECSSSSCEECCSCCTTCEEEEECTTCEEEEETT
T ss_pred             ccceEcCCEEEEEEcchhcccccceEeccccccCceEEEEEEECCceEcCCCCEecCCeeecCCEEEEcccCceEEEECC
Confidence            489999999999999999999999999999 578999999999999988655 567899999999999999999999999


Q ss_pred             EEEEEEecCceEEEecC
Q 044904          139 KDYHLYRDEEILGTLHD  155 (155)
Q Consensus       139 ~ey~ivre~DILAvi~~  155 (155)
                      ++|++++++||||++++
T Consensus        83 ~~y~ii~e~dIlavi~~   99 (99)
T d1p3ha_          83 EEYLILSARDVLAVVSK   99 (99)
T ss_dssp             EEEEEEEGGGEEEEEEC
T ss_pred             EEEEEEEHHHEEEEEeC
Confidence            99999999999999985
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g31a_ b.35.1.1 (A:) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure