Citrus Sinensis ID: 045010

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MSDQSRPMTQALYEKAPSTPLAVKFLTAATIGGTLLFLSGLTLTGTVIALIMATPVLVLFSPILVPAAIAVFLATVGFLVSGGCGVTAITVLSWIYSYVKGKHPPGADHLDYARTKIADKARDMTERAKEYGQYVQQKAQEATQAS
ccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
*******************PLAVKFLTAATIGGTLLFLSGLTLTGTVIALIMATPVLVLFSPILVPAAIAVFLATVGFLVSGGCGVTAITVLSWIYSYVKGKHP***DHLDYA*********************************
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxHHHHHHHxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDQSRPMTQALYEKAPSTPLAVKFLTAATIGGTLLFLSGLTLTGTVIALIMATPVLVLFSPILVPAAIAVFLATVGFLVSGGCGVTAITVLSWIYSYVKGKHPPGADHLDYARTKIADKARDMTERAKEYGQYVQQKAQEATQAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Oleosin 16 kDa May have a structural role to stabilize the lipid body during desiccation of the seed by preventing coalescence of the oil. Probably interacts with both lipid and phospholipid moieties of lipid bodies. May also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth.probableQ42980

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted