Citrus Sinensis ID: 045071


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450---
MEAFNTLSMASPFSYTFTSSSSSCGSGSGSGTATSNNPMFTACPWMDSRIWSKLPQRLLDRVLAFLPPPAFFRARAVCKRWYGLLFSNSFLELYIHVSPRHHWFLFFNQKTPLIKTTSYIYTTNNNSIRSAAAATCCEGYLFDPHELSWYRISFALVPSEFSPASSSGGLVCWVSDHAGAKTLILCNPVTGSLSQLPPTLRPRLFPSIGLKVTPTAVDVTVAGDDLISPYAVKNLSSESFHIDAGGFFSLWGTTSSLPRLCSLESGRMVQVNGKFYCMNYSPFSVLAYDISANAWFNIQAPMRRFLRSPSLLDSNGKLILVAAVEKSKLNVPKSLRLWSLQACGTLWAEIERMPQQLYAQFAEIEAGNGFDTIGHGEFIVIVIRGSDKALLFDLCMKSWQWIPRCPYVQANNCGGNYGDGEGELHGFAYEPRLATPVTALLDQLTLPFQSFSG
ccccccccccccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHHHHcccHHHHHHHccccHHHHHHcccHHHHHHHHccccccccEEEEEccccccccccEEEEccccccccccccccccccccccccccCEECcccccccccEEEEEcccEEEEEEcccccCEEEEEccccccEECcccccccccccEEEEEEccccEEEEEEECcccccccEEEcCEEEEEEEcccCEEEEECccccccccccccccEEEEccEEEEEcccccEEEEEEccccCEEEECccccccccccCEEEEccEEEEEEEEEccccccccEEEEEEEEccccEEEEEEEEcHHHHHHHccccccccEEEEECccEEEEEEEcccEEEEEEcccccEEEccccccccccccccccccccccEEEEECcccccccHHHHHHHHccccccccc
**************************************MFTACPWMDSRIWSKLPQRLLDRVLAFLPPPAFFRARAVCKRWYGLLFSNSFLELYIHVSPRHHWFLFFNQKTPLIKTTSYIYTTNNNSIRSAAAATCCEGYLFDPHELSWYRISFALVPSEFSPASSSGGLVCWVSDHAGAKTLILCNPVTGSLSQLPPTLRPRLFPSIGLKVTPTAVDVTVAGDDLISPYAVKNLSSESFHIDAGGFFSLWGTTSSLPRLCSLESGRMVQVNGKFYCMNYSPFSVLAYDISANAWFNIQAPMRRFLRSPSLLDSNGKLILVAAVEKSKLNVPKSLRLWSLQACGTLWAEIERMPQQLYAQFAEIEAGNGFDTIGHGEFIVIVIRGSDKALLFDLCMKSWQWIPRCPYVQANNCGGNYGDGEGELHGFAYEPRLATPVTALLDQLTLPFQSF**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAFNTLSMASPFSYTFTSSSSSCGSGSGSGTATSNNPMFTACPWMDSRIWSKLPQRLLDRVLAFLPPPAFFRARAVCKRWYGLLFSNSFLELYIHVSPRHHWFLFFNQKTPLIKTTSYIYTTNNNSIRSAAAATCCEGYLFDPHELSWYRISFALVPSEFSPASSSGGLVCWVSDHAGAKTLILCNPVTGSLSQLPPTLRPRLFPSIGLKVTPTAVDVTVAGDDLISPYAVKNLSSESFHIDAGGFFSLWGTTSSLPRLCSLESGRMVQVNGKFYCMNYSPFSVLAYDISANAWFNIQAPMRRFLRSPSLLDSNGKLILVAAVEKSKLNVPKSLRLWSLQACGTLWAEIERMPQQLYAQFAEIEAGNGFDTIGHGEFIVIVIRGSDKALLFDLCMKSWQWIPRCPYVQANNCGGNYGDGEGELHGFAYEPRLATPVTALLDQLTLPFQSFSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein UNUSUAL FLORAL ORGANS Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Considered as a meristem identity factor required for normal growth of the young floral meristem. Acts together with LEAFY to positively regulate the B class floral homeotic genes APETALA3 and PISTILLATA. In this way, operates as a region-specific regulator for petal and stamen development. Alternatively, may play a role as a negative regulator of the C class floral homeotic genes. Interacts together with the SKP1-like protein ASK1 to form a ubiquitin E3 ligase complex and could indirectly promote the ubiquitination and degradation of specific proteins controlling the floral primordia development like repressors of B class floral homeotic genes.probableQ39090

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2UVK, chain A
Confidence level:confident
Coverage over the Query: 138-357,368-403
View the alignment between query and template
View the model in PyMOL
Template: 2E31, chain A
Confidence level:confident
Coverage over the Query: 69-97
View the alignment between query and template
View the model in PyMOL
Template: 3MBR, chain X
Confidence level:probable
Coverage over the Query: 209-432
View the alignment between query and template
View the model in PyMOL