Citrus Sinensis ID: 045086

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520--

MESGGKRRRTDAVLSNGNDKIDPSLLEALEKSQSSVEALDLRTVKKLVLSFERRLKENIEARLKYPDQPEKFADTEVDLHEELEKLKVLAGGPELYPDVVNLNVIPSILGLLSHDNTDIAIDVVHLLQDLTDEDVLEDNDEPARVLVDALIENNVLELLVQNIQRLSDADSDPDEMAAVYNTLATIENLIEVKPSVAELVCERTKLLRWLLGKIKVREFDSNKQYASEILAILLQNSTANQKRLGQMNGVDVLLQAVAMYKSKDPKTSDEEEMLENLFDSLCCVLMPLENKERFVKAEGVELMIIIMKQKKSAYASAIRALDFAMTKYPPACERFVDVLGLKTAFAAFMGKIPVNKKNKKERYQEELEERLVSLIASLFGGILRGSRRERLLSKFIENECEKIDRLMELYMRYSDRVRAETDRLNELELDDLEMDEEEKYNRKLESGLYTLQLIAVILGHLWCSEQPQMRTRIELLLKQQKLTKKDVKDILQEYHDNIGDLDGPEEKERAQARIQKFISAFG

ccccccccccHHccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc

**************************************LDLRTVKKLVLSFERRLKENIEARLKYPDQPEKFADTEVDLHEELEKLKVLAGGPELYPDVVNLNVIPSILGLLSHDNTDIAIDVVHLLQDLTDEDVLEDNDEPARVLVDALIENNVLELLVQNIQRLSDADSDPDEMAAVYNTLATIENLIEVKPSVAELVCERTKLLRWLLGKIKVREFDSNKQYASEILAILLQNSTANQKRLGQMNGVDVLLQAVAMYKS**P**SDEEEMLENLFDSLCCVLMPLENKERFVKAEGVELMIIIMKQKKSAYASAIRALDFAMTKYPPACERFVDVLGLKTAFAAFMGKIP************ELEERLVSLIASLFGGILRGSRRERLLSKFIENECEKIDRLMELYMRYSDRVRA******************EKYNRKLESGLYTLQLIAVILGHLWCSEQPQMRTRIELLLKQQKLTKKDVKDILQEYHD******************QKFISAFG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MESGGKRRRTDAVLSNGNDKIDPSLLEALEKSQSSVEALDLRTVKKLVLSFERRLKENIEARLKYPDQPEKFADTEVDLHEELEKLKVLAGGPELYPDVVNLNVIPSILGLLSHDNTDIAIDVVHLLQDLTDEDVLEDNDEPARVLVDALIENNVLELLVQNIQRLSDADSDPDEMAAVYNTLATIENLIEVKPSVAELVCERTKLLRWLLGKIKVREFDSNKQYASEILAILLQNSTANQKRLGQMNGVDVLLQAVAMYKSKDPKTSDEEEMLENLFDSLCCVLMPLENKERFVKAEGVELMIIIMKQKKSAYASAIRALDFAMTKYPPACERFVDVLGLKTAFAAFMGKIPVNKKNKKERYQEELEERLVSLIASLFGGILRGSRRERLLSKFIENECEKIDRLMELxxxxxxxxxxxxxxxxxxxxxDLEMDEEEKYNRKLESGLYTLQLIAVILGHLWCSEQPQMRTRIELLLKQQKLTKKDVKDILQEYHDNIGDLDGPEEKERAQARIQKFISAFG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Beta-catenin-like protein 1	Induces apoptosis in CHO cells.	probable	Q8WYA6
Beta-catenin-like protein 1	Induces apoptosis in CHO cells.	probable	Q9CWL8
Beta-catenin-like protein 1	Induces apoptosis in CHO cells.	probable	O62703

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JDH, chain A
Confidence level:confident
Coverage over the Query: 79-351,363-412
View the alignment between query and template
View the model in PyMOL

Template: 1XM9, chain A
Confidence level:probable
Coverage over the Query: 80-418
View the alignment between query and template
View the model in PyMOL