Citrus Sinensis ID: 045110


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------
MNRDGLVVTAVDQSSLKKKTAVSSSWILLDREAQSTTLDVDKHVIMRRVQIHARDLRILDPMLNYPSTILGREKVIVLNLEHIKAIITADEVLLRDPMDDNVIPIVEQLQRRLASDYPISQGQGEEEDNHPGVRNNFETEAICSFLDARTRELETDAYPALDELTSKISSRNLDRVRKLKSAMTRLTNRVQKVRDELEQLLDDDDDMADLYLSRKLAVASSPVSGSGAPHWFLNSPTIGSKISRTISRGSMETTQEENDVEELEMLLEAYFMQIDGTLNKLSTLREYIDDTEDYINIQLDNHRNQLIQLELFLCSGTVCLSVYSLVAAIFGMNIPYTWKTGHGYVFKWVVVITGIVCALLFSIIIFYARHKGLVGS
ccccccccccccccccccccccEEEEEEEcccccEEEEECcHHHHHHHccccccccccccccccccCEEcccccEEEEEcccEEEEEEccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
*********************VSSSWILLDREAQSTTLDVDKHVIMRRVQIHARDLRILDPMLNYPSTILGREKVIVLNLEHIKAIITADEVLLRDPMDDNVIPIVEQLQRRLAS************DNHPGVRNNFETEAICSFLDARTRELETDAYPALDELTSKISSRNLDRVRKLKSAMTRLTNRVQKVRDELEQLLDDDDDMADLYLSRKLA****************************************NDVEELEMLLEAYFMQIDGTLNKLSTLREYIDDTEDYINIQLDNHRNQLIQLELFLCSGTVCLSVYSLVAAIFGMNIPYTWKTGHGYVFKWVVVITGIVCALLFSIIIFYARHKGLVG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNRDGLVVTAVDQSSLKKKTAVSSSWILLDREAQSTTLDVDKHVIMRRVQIHARDLRILDPMLNYPSTILGREKVIVLNLEHIKAIITADEVLLRDPMDDNVIPIVEQLQRRLASDYPISQGQGEEEDNHPGVRNNFETEAICSFLDARTRELETDAYPALDELTSKISSRNLDRxxxxxxxxxxxxxxxxxxxxxxxxxxxxDDDMADLYLSRKLAVASSPVSGSGAPHWFLNSPTIGSKISRTISRGSMETTQEENDVEELEMLLEAYFMQIDGTLNKLSTLREYIDDTEDYINIQLDNHRNQLIQLELFLCSGTVCLSVYSLVAAIFGMNIPYTWKTGHGYVFKWVVVITGIVCALLFSIIIFYARHKGLVGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Magnesium transporter MRS2-I Magnesium transporter that may mediate the influx of magnesium.confidentQ10D38
Magnesium transporter MRS2-I Magnesium transporter that may mediate the influx of magnesium.probableB8AJT9
Magnesium transporter MRS2-7 Low-affinity magnesium transporter that mediates the influx of magnesium.probableQ304A0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RKG, chain A
Confidence level:very confident
Coverage over the Query: 20-117,132-217,256-303
View the alignment between query and template
View the model in PyMOL
Template: 4EV6, chain A
Confidence level:confident
Coverage over the Query: 20-208,260-374
View the alignment between query and template
View the model in PyMOL