Citrus Sinensis ID: 045139


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820
MVIGGGRCRSLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNMLMRAT
ccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccEEEEEccccccccccCCccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHHccccccccccEEEccccccCECcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEEccHHHccccccccEEEccccEEEEECcccccccccccEEEECcccccccccHHccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccCCcccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccCECccccccccccccEEEcccccccccccHHHHHHHccccccccccCEECccccccCEEEEEEEEEcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccc
*****GRCRSLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKS*****RYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNMLMRA*
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIGGGRCRSLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNMLMRAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OZN, chain A
Confidence level:very confident
Coverage over the Query: 572-718,760-819
View the alignment between query and template
View the model in PyMOL
Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 75-86,97-174,200-330
View the alignment between query and template
View the model in PyMOL
Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 243-376,387-440,466-718,760-819
View the alignment between query and template
View the model in PyMOL
Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 88-174,200-380,391-446,470-524,572-703
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 40-174,200-378
View the alignment between query and template
View the model in PyMOL
Template: 3G06, chain A
Confidence level:very confident
Coverage over the Query: 63-375,386-419
View the alignment between query and template
View the model in PyMOL
Template: 2Z7X, chain B
Confidence level:very confident
Coverage over the Query: 271-374,385-549,572-718,760-819
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:confident
Coverage over the Query: 215-453,465-718,760-816
View the alignment between query and template
View the model in PyMOL
Template: 3RIZ, chain A
Confidence level:confident
Coverage over the Query: 287-816
View the alignment between query and template
View the model in PyMOL