Citrus Sinensis ID: 045139


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820
MVIGGGRCRSLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNMLMRAT
ccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccEEEccccccEEEEEccccccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccHHccccccccEEEcccccccccccHHHHHcccccccEEEcccccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHHccccccccccEEEccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEccccccEEEccHHHccccccccEEEccccEEEEEEcccccccccccEEEEEcccccccccHHccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccEEcccccHHHHHcccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHHHccccccccccEEEEccccccEEEEEEEEEEcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccc
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEcccccEEEEEEEEccccccccccccHHHHccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEccccccccccccHHHHccccccEEEEccccccccccccHHHHHHHHcccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHHcccHcccEEEccccccccccHHHHccccccEEEcccccccccccHHHHcccccccccccEEEcccccccccccccccccccccccccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHcccccEEEEccccccccccccccccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHHHHHHHccEEEccccccccccccccccccEEEcccccccccccHHHccccccEEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccEEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcHHHHHEEEcccccccccccHHHcccccEEEEccccccHcccccEEEEEEcccccccccccccccHHcccEEEcccccccccccHHHHHHHHccEEEcccccccccc
mvigggrcrsLQLLFVFILLSLcmkpavglstgdedadIKCIERERQALLMFKQGLIdeyghlsswgneddkkdcckwrgvscsnqtghvtmLNLQfrsymplrgnisssliglqHLNYLNMKyndfggkqipafigslknirhldlsnagftgrvpyqlgnltslqyldlsFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSqlpsltelqlrgcnlpsviasssvsfsnssrslaHLDLSLNDVSNSVYYWLFNSSSslvyldlssnklqgpipdsafpnptslsyldlsnnqlvsvPKSFRNLCRLRALyqdsnnltdlLPNLFLKLSNCSRDTLEILQLNSnmlrgslpditlfsslkelhlYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLsnlsrltyldlsHNSLilnfgsgwvpsfeLNIIRlgackqgpqfpkwlqtqnkfseldvsaaeisdtvpnwfwdlspnlyylnlshnhftgmlpdlsqkftayppeidlsansfegpippipltvTSLILFKNMFSGSLSFLCQISDEHFRyldlsdnllsgelpncsknWQKLTVLNLAnnkfsgkipdsmdfNCMMLSLhlrnnsfigelpssvksftqltvldlghnkisgiipawigdslpDLVVLSLRsnnfhgrvpvqVCHLQRIQvldlsqnnisgtvpQCLNNLtamtankssnamiryplrtdyyndhALLVWKRKDSEYRNTLGLVksidlssnrlygeipevtSLVGLISlnlsknsltgpipskiggltllnslDLSKNMLMRAT
mvigggrcrsLQLLFVFILLSLCMKPAVglstgdedadIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVscsnqtghvTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGlvksidlssnrlYGEIPEVTSLVGLISLNLSKNSltgpipskiggltllnsldlsknmlmrat
MVIGGGRCRslqllfvfillslCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPsviasssvsfsnssrsLAHLDLSLNDVSNSVYYWLFNsssslvyldlssNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNMLMRAT
***GGGRCRSLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIA************LAHLDLSLNDVSNSVYYWLF*******************************SYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNL**************YPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSL***********
************LLFVFILLSLCMKPAVGLSTGD******CIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKS*****RYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNMLMRA*
MVIGGGRCRSLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIAS*********RSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNMLMRAT
*****GRCRSLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNML****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIGGGRCRSLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNMLMRAT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query820 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.797 0.772 0.304 8e-61
Q9FL28 1173 LRR receptor-like serine/ no no 0.871 0.609 0.296 3e-51
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.768 0.503 0.298 8e-51
C0LGS2 1136 Probable LRR receptor-lik no no 0.821 0.593 0.299 3e-50
Q9LP24 1120 Probable leucine-rich rep no no 0.792 0.580 0.292 4e-46
C0LGQ5 1249 LRR receptor-like serine/ no no 0.886 0.582 0.291 4e-46
Q9LYN8 1192 Leucine-rich repeat recep no no 0.736 0.506 0.310 1e-44
Q9LVP0 1102 Probable leucine-rich rep no no 0.75 0.558 0.300 2e-44
Q9LRT1 1016 Probably inactive leucine no no 0.696 0.562 0.282 1e-40
Q9LHP4 1141 Receptor-like protein kin no no 0.619 0.445 0.319 3e-40
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  235 bits (600), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 246/807 (30%), Positives = 381/807 (47%), Gaps = 153/807 (18%)

Query: 41  CIERERQALLMFKQGL-IDEYGH-LSSW-GNEDDKKDCCKWRGVSCSNQTGHVTMLNLQF 97
           C + +R ALL F+    I+   H ++ W G  +   DCC W GV+C++++G V  L++  
Sbjct: 34  CRDDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIP- 92

Query: 98  RSYMPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVP 157
            +++      +SSL  LQ+L                         RHLDL+N    G +P
Sbjct: 93  NTFLNNYLKTNSSLFKLQYL-------------------------RHLDLTNCNLYGEIP 127

Query: 158 YQLGNLTSLQYLDLSFN--FDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQLP 215
             LGNL+ L  ++L FN     +   +  L+QL  L  +  N V  GE    L  +S+L 
Sbjct: 128 SSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHL--ILANNVLTGEIPSSLGNLSRLV 185

Query: 216 SLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDL 275
           +L EL                 FSN  R +  +  S+ D+              L  L L
Sbjct: 186 NL-EL-----------------FSN--RLVGKIPDSIGDLK------------QLRNLSL 213

Query: 276 SSNKLQGPIPDSAFPNPTSLSYLDLSNNQLV-SVPKSFRNLCRLRALYQDSNNLTDLLPN 334
           +SN L G IP S+  N ++L +L L++NQLV  VP S  NL  LR +  ++N+L+  +P 
Sbjct: 214 ASNNLIGEIP-SSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPI 272

Query: 335 LFLKLSNCSRDTLEILQLNSNMLRGSLP-DITLFSSLKELHLYDNM-------------- 379
            F  L+      L I  L+SN    + P D+++F +L+   +  N               
Sbjct: 273 SFANLT-----KLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPS 327

Query: 380 LDVLYLNNNRFTGTLT-KSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNS 438
           L+ +YL  N+FTG +   +    ++L+ L +  N L G I E+ +S L  L  LD+SHN+
Sbjct: 328 LESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPES-ISRLLNLEELDISHNN 386

Query: 439 LILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDL 498
                 +G +P               P   K +        LD+S   +   VP   W L
Sbjct: 387 F-----TGAIP---------------PTISKLVN----LLHLDLSKNNLEGEVPACLWRL 422

Query: 499 SPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMF 558
           +     + LSHN F+    + SQ+  A   E+DL++NSF+GPIP +              
Sbjct: 423 NT----MVLSHNSFSS-FENTSQE-EALIEELDLNSNSFQGPIPYM-------------- 462

Query: 559 SGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQ-KLTVLNLANNKFSGKIPDSMDF 617
                 +C++S     +LDLS+NL SG +P+C +N+   +  LNL +N FSG +PD    
Sbjct: 463 ------ICKLSS--LGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSK 514

Query: 618 NCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRS 677
              ++SL + +N   G+ P S+ +   L ++++  NKI  I P+W+ +SLP L VL+LRS
Sbjct: 515 ATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWL-ESLPSLHVLNLRS 573

Query: 678 NNFHGRVPVQVCH----LQRIQVLDLSQNNISGTVP-QCLNNLTAMTA--NKSSNAMIRY 730
           N F+G  P+   H     Q ++++D+S NN SGT+P    +N   MT    +    M  +
Sbjct: 574 NKFYG--PLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEF 631

Query: 731 PLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPE-VTSLVGLISLNLSK 789
               D Y     +V K  D  +       ++ID S N++ G IPE +  L  L  LNLS 
Sbjct: 632 WRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSG 691

Query: 790 NSLTGPIPSKIGGLTLLNSLDLSKNML 816
           N+ T  IP  +  LT L +LD+S+N L
Sbjct: 692 NAFTSVIPRFLANLTKLETLDISRNKL 718




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query820
225464712 1021 PREDICTED: receptor-like protein 12-like 0.951 0.763 0.486 0.0
359490572 975 PREDICTED: probable LRR receptor-like se 0.967 0.813 0.501 0.0
224105895 963 predicted protein [Populus trichocarpa] 0.964 0.821 0.490 0.0
147807651 971 hypothetical protein VITISV_018647 [Viti 0.924 0.780 0.475 0.0
359490576 972 PREDICTED: LRR receptor-like serine/thre 0.904 0.763 0.485 0.0
224105891 1036 predicted protein [Populus trichocarpa] 0.948 0.750 0.484 0.0
225462661 1485 PREDICTED: LRR receptor-like serine/thre 0.912 0.503 0.477 0.0
224116866 994 predicted protein [Populus trichocarpa] 0.929 0.766 0.478 0.0
225466147 1024 PREDICTED: LRR receptor-like serine/thre 0.943 0.755 0.452 0.0
255560149 1010 serine-threonine protein kinase, plant-t 0.975 0.792 0.450 0.0
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/893 (48%), Positives = 558/893 (62%), Gaps = 113/893 (12%)

Query: 10  SLQLLFVFILLSLCMKPAVGLSTGDEDADIKCIERERQALLMFKQGLIDEYGHLSSWGNE 69
           S Q    F LL LC KP  GL +G       C+E+ERQALL FKQGL+D++G LSSWGNE
Sbjct: 30  SFQHFISFTLLLLCSKP--GLGSG-------CVEKERQALLDFKQGLVDDFGILSSWGNE 80

Query: 70  DDKKDCCKWRGVSCSNQTGHVTMLNLQ------FRSYMPLRGNISSSLIGLQHLNYLNMK 123
           +D++DCCKWRGV CSN+T HV ML+L          Y  LRG ISSSL+ LQHLN+L++ 
Sbjct: 81  EDRRDCCKWRGVQCSNRTSHVIMLDLHALPTDTVHKYQSLRGRISSSLLELQHLNHLDLS 140

Query: 124 YNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLE 183
            NDF G  +P FIG    +R+L+LS A   G +P  LGNL++L +LDLS N+ M S+ LE
Sbjct: 141 LNDFQGSYVPEFIGLFSKLRYLNLSEARLAGMIPSHLGNLSNLHFLDLSRNYGMSSETLE 200

Query: 184 WLSQLSFLEYVRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSR 243
           WLS+LS L ++ L+ +NL +A  W  V+++LPSLT+L L    LP +I  S++S++NSS+
Sbjct: 201 WLSRLSSLRHLDLSGLNLDKAIYWEHVINRLPSLTDLLLHDSALPQIITPSALSYTNSSK 260

Query: 244 SLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKLQGPIPDS---------------- 287
           SL  LDLS N +S+SVY WLFN SSSLV+LDLS N++QG IPD+                
Sbjct: 261 SLVVLDLSWNFLSSSVYPWLFNLSSSLVHLDLSINQIQGLIPDTFGEMVSLEYLDLFFNQ 320

Query: 288 ------------------------------AFPNPTSLSYLDLSNNQLVS-VPKSFRNLC 316
                                          F + TSLSYLDLS NQL   +PKSF+NLC
Sbjct: 321 LEGEIPQSLTSTSLVHLDLSVNHLHGSIPDTFGHMTSLSYLDLSLNQLEGGIPKSFKNLC 380

Query: 317 RLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLY 376
            L+ +   SN+LT  LP       +CS+DTLE+L L+ N   GS P+ T FS L  L   
Sbjct: 381 SLQMVMLLSNSLTAQLPEFVQNSLSCSKDTLEVLVLSWNQFTGSFPNFTGFSVLGHL--- 437

Query: 377 DNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSH 436
                  Y+++NR  GT  + IGQLSQLE+L+++ NSL G ITEAHLS+LS+L +LDLS 
Sbjct: 438 -------YIDHNRLNGTFPEHIGQLSQLEVLEISGNSLHGNITEAHLSSLSKLYWLDLSS 490

Query: 437 NSLILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFW 496
           NSL L     W P F++  + L +CK GP FP WLQTQ     LD+S + ISD +P+WFW
Sbjct: 491 NSLALELSPEWTPPFQVGYLGLLSCKMGPNFPGWLQTQKDLFSLDISNSSISDVIPSWFW 550

Query: 497 DLSPNLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKN 556
           +L+  L  L +++N   G +P L  +  A    IDLS N FEGPIP +P  V  L L KN
Sbjct: 551 NLTSKLIKLRIANNQIRGRVPSLRMETAAV---IDLSLNRFEGPIPSLPSGVRVLSLSKN 607

Query: 557 MFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQ-KLTVLNLANNKFSGKIPDSM 615
           +FSGS+S LC I D    YLDLSDNLLSG LP+C + W+ +L +LNLANN FSGK+P S+
Sbjct: 608 LFSGSISLLCTIVDGALSYLDLSDNLLSGALPDCWQQWRDQLQILNLANNNFSGKLPYSL 667

Query: 616 DFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSL 675
                + +LHL NN F+GELPSS+ + T+L ++D+G N+ SG IP WIG+ L DLVVLSL
Sbjct: 668 GSLAALQTLHLYNNGFLGELPSSLMNCTKLRLVDMGKNRFSGEIPTWIGERLSDLVVLSL 727

Query: 676 RSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTD 735
           RSN FHG +   +C L+ +Q+LD S+NNISGT+P+CLNN TAM     +  MI   +  D
Sbjct: 728 RSNEFHGSISSDICLLKELQILDFSRNNISGTIPRCLNNFTAM-----AQKMIYSVIAHD 782

Query: 736 Y-------------------------------YNDHALLVWKRKDSEYRNTLGLVKSIDL 764
           Y                               Y D AL+ WK  + EY+N LGLV+SIDL
Sbjct: 783 YLALSIVPRGRNNLGITPRWAYSSGSFDTIARYVDSALIPWKGGEFEYKNILGLVRSIDL 842

Query: 765 SSNRLYGEIP-EVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNML 816
           SSN+L GEIP E+T L+ LISLNLS+N L G IPS IG L  L+ LDLSKN L
Sbjct: 843 SSNKLSGEIPKEITKLMELISLNLSRNHLNGQIPSMIGQLKSLDVLDLSKNQL 895




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147807651|emb|CAN64389.1| hypothetical protein VITISV_018647 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224105891|ref|XP_002333752.1| predicted protein [Populus trichocarpa] gi|222838400|gb|EEE76765.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225462661|ref|XP_002266475.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116866|ref|XP_002331833.1| predicted protein [Populus trichocarpa] gi|222875071|gb|EEF12202.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560149|ref|XP_002521092.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223539661|gb|EEF41243.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query820
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.909 0.824 0.303 2.4e-69
TAIR|locus:2144392 957 RLP53 "receptor like protein 5 0.873 0.748 0.304 1.2e-67
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.878 0.805 0.306 5.1e-67
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.823 0.686 0.320 1.2e-66
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.858 0.746 0.301 1.5e-65
TAIR|locus:2046357 890 RLP23 "receptor like protein 2 0.786 0.724 0.289 9.8e-65
TAIR|locus:2046585 808 RLP27 "receptor like protein 2 0.673 0.683 0.318 1.9e-60
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.786 0.567 0.314 3.1e-57
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.760 0.736 0.297 8.6e-56
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.604 0.556 0.300 1.3e-55
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 703 (252.5 bits), Expect = 2.4e-69, P = 2.4e-69
 Identities = 251/827 (30%), Positives = 382/827 (46%)

Query:    37 ADIKCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQ 96
             A  KCI  ERQALL F+  L D    L SW   D    CC W GV C  +T HV  ++L+
Sbjct:    29 ASPKCISTERQALLTFRAALTDLSSRLFSWSGPD----CCNWPGVLCDARTSHVVKIDLR 84

Query:    97 -----FRS--YM--PLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDL 147
                   RS  Y    LRG I  SL  L+ L+YL++  NDF   +IP FIG + ++R+L+L
Sbjct:    85 NPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNL 144

Query:   148 SNAGFTGRVPYQLGNLTSLQYLDL---SFN----FDMLSKKLEWLSQLSF-LEYVRLNQV 199
             S++ F+G +P  LGNL+ L+ LDL   SF       + +  L WLS LS  L+Y+ +  V
Sbjct:   145 SSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRASNLRWLSSLSSSLKYLNMGYV 204

Query:   200 NL-GEATDWLQVVSQLPSLTELQLRGCNLPXXXXXXXXXXXXXXXXLAHLDLSLNDVSNS 258
             NL G    WLQ  S++ +L EL L    L                 L  LDLS N +++ 
Sbjct:   205 NLSGAGETWLQDFSRISALKELHLFNSELKNLPPTLSSSADLKL--LEVLDLSENSLNSP 262

Query:   259 VYYWLFNXXXXXXXXXXXXNKLQGPIPDSAFPNPTSLSYLDLSNNQLVS--VPKSFRNLC 316
             +  WLF             + LQG IP + F N   L  LDLSNN  +   +P    +L 
Sbjct:   263 IPNWLFGLTNLRKLFLRW-DFLQGSIP-TGFKNLKLLETLDLSNNLALQGEIPSVLGDLP 320

Query:   317 RLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLY 376
             +L+ L   +N L   +       S    ++L  L L+SN L G+LP+     SL+ L   
Sbjct:   321 QLKFLDLSANELNGQIHGFLDAFSRNKGNSLVFLDLSSNKLAGTLPES--LGSLRNLQTL 378

Query:   377 DNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSH 436
             D       L++N FTG++  SIG ++ L+ LD+++N++ G I E+ L  L+ L  L+L  
Sbjct:   379 D-------LSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAES-LGQLAELVDLNLMA 430

Query:   437 NSL--ILNFGSGWVPSFELNIIRLGACKQGP---QFPK-WLQTQNKFSELDVSAAEISDT 490
             N+   +L   S +V    L  IRL          + P  W+    +   + +    I   
Sbjct:   431 NTWGGVLQ-KSHFVNLRSLKSIRLTTEPYRSLVFKLPSTWIPPF-RLELIQIENCRIG-L 487

Query:   491 VPNWFWDLSPNLYYLNLSHNHFTGMLPD-----LSQKFTAYPPEIDLSANSFEGPIPP-- 543
              P W   +   L ++ L +      +PD     +S K T Y   + L+ N  +G +P   
Sbjct:   488 FPMWL-QVQTKLNFVTLRNTGIEDTIPDSWFSGISSKVT-Y---LILANNRIKGRLPQKL 542

Query:   544 -IPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELP-NCSKNWQKLTVLN 601
               P  + ++ L  N F G+       + E    L L +N  SG LP N      ++  + 
Sbjct:   543 AFP-KLNTIDLSSNNFEGTFPLWSTNATE----LRLYENNFSGSLPQNIDVLMPRMEKIY 597

Query:   602 LANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPA 661
             L +N F+G IP S+     +  L LR N F G  P        L  +D+  N +SG IP 
Sbjct:   598 LFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPE 657

Query:   662 WIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTAN 721
              +G  LP L VL L  N+  G++P  + +   +  +DL  N ++G +P  +  L+++   
Sbjct:   658 SLG-MLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFML 716

Query:   722 KSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIPEV-TSLV 780
             +  +      +  D  N   L +     ++    +   K I   +    G   EV  +LV
Sbjct:   717 RLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIP--KCISNLTAIARGTNNEVFQNLV 774

Query:   781 GLI-----------SLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNML 816
              ++           S+NLS N+++G IP +I GL  L  L+LS+N +
Sbjct:   775 FIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSM 821


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query820
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-56
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-43
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-07
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  208 bits (530), Expect = 4e-56
 Identities = 202/674 (29%), Positives = 313/674 (46%), Gaps = 148/674 (21%)

Query: 45  ERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLR 104
           E + LL FK  + D   +LS+W   +   D C W+G++C+N +  V  ++L  ++   + 
Sbjct: 30  ELELLLSFKSSINDPLKYLSNW---NSSADVCLWQGITCNNSS-RVVSIDLSGKN---IS 82

Query: 105 GNISSSLIGLQH-------------------------LNYLNMKYNDFGGKQIPAFIGSL 139
           G ISS++  L +                         L YLN+  N+F G  IP   GS+
Sbjct: 83  GKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGS-IPR--GSI 139

Query: 140 KNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQV 199
            N+  LDLSN   +G +P  +G+ +SL+ LDL  N  ++ K    L+ L+ LE++ L   
Sbjct: 140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV-LVGKIPNSLTNLTSLEFLTL--- 195

Query: 200 NLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSV 259
               A++  Q+V Q+P   EL                      +SL  + L  N++S  +
Sbjct: 196 ----ASN--QLVGQIPR--EL-------------------GQMKSLKWIYLGYNNLSGEI 228

Query: 260 YYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLV-SVPKSFRNLCRL 318
            Y +    +SL +LDL  N L GPIP S+  N  +L YL L  N+L   +P S  +L +L
Sbjct: 229 PYEI-GGLTSLNHLDLVYNNLTGPIP-SSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKL 286

Query: 319 RALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDN 378
            +L    N+L+  +P L ++L N     LEIL L SN   G +P     +SL  L     
Sbjct: 287 ISLDLSDNSLSGEIPELVIQLQN-----LEILHLFSNNFTGKIP--VALTSLPRLQ---- 335

Query: 379 MLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNS 438
              VL L +N+F+G + K++G+ + L +LD+++N+L G I E  L +   L  L L  NS
Sbjct: 336 ---VLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEG-LCSSGNLFKLILFSNS 391

Query: 439 LILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDL 498
           L      G +P        LGAC+                                    
Sbjct: 392 L-----EGEIPK------SLGACR------------------------------------ 404

Query: 499 SPNLYYLNLSHNHFTGMLPDLSQKFTAYPPE--IDLSANSFEGPIPPIPLTVTSL---IL 553
             +L  + L  N F+G   +L  +FT  P    +D+S N+ +G I      + SL    L
Sbjct: 405 --SLRRVRLQDNSFSG---ELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSL 459

Query: 554 FKNMFSGSL--SFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKI 611
            +N F G L  SF      +    LDLS N  SG +P    +  +L  L L+ NK SG+I
Sbjct: 460 ARNKFFGGLPDSF----GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEI 515

Query: 612 PDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLV 671
           PD +     ++SL L +N   G++P+S      L+ LDL  N++SG IP  +G ++  LV
Sbjct: 516 PDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLG-NVESLV 574

Query: 672 VLSLRSNNFHGRVP 685
            +++  N+ HG +P
Sbjct: 575 QVNISHNHLHGSLP 588


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 820
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
PLN03150623 hypothetical protein; Provisional 99.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.36
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.32
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.23
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
PLN03150623 hypothetical protein; Provisional 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.89
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.71
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.56
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.53
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.26
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.22
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.01
KOG4341483 consensus F-box protein containing LRR [General fu 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.86
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.72
KOG4341483 consensus F-box protein containing LRR [General fu 97.72
PRK15386 426 type III secretion protein GogB; Provisional 97.6
PRK15386 426 type III secretion protein GogB; Provisional 97.58
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.54
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.52
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.22
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.47
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.46
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.89
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.48
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.12
KOG4308478 consensus LRR-containing protein [Function unknown 94.74
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.47
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.47
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.54
KOG4308478 consensus LRR-containing protein [Function unknown 88.55
smart0037026 LRR Leucine-rich repeats, outliers. 87.94
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.94
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.57
smart0037026 LRR Leucine-rich repeats, outliers. 87.57
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.92
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.52
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.88
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1e-67  Score=648.77  Aligned_cols=576  Identities=33%  Similarity=0.516  Sum_probs=411.7

Q ss_pred             CHHHHHHHHHhhccCCCCCCCCCCCCCCCCCCCCcccCceEecCCCCcEEEEEcCCCCCCCCcccccccccCCCCCCEEE
Q 045139           42 IERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGNISSSLIGLQHLNYLN  121 (820)
Q Consensus        42 ~~~~~~~l~~~~~~~~~~~~~~~~W~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~~l~g~i~~~l~~l~~L~~L~  121 (820)
                      .++|++||++||+++.+|.+.+.+|.   .+.+||.|.||+|++ .++|+.|+|++   +.++|.+++++..+++|++|+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~---~~i~~~~~~~~~~l~~L~~L~   99 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSG---KNISGKISSAIFRLPYIQTIN   99 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecC---CCccccCChHHhCCCCCCEEE
Confidence            44789999999999988888889997   467899999999975 57999999998   889999999999999999999


Q ss_pred             CcCCCCCCcccCcccc-CCCCCCEEeccCCCCCCCCCccCCCCCCCcEEeCCCCccccccchhhccCCCCCCeeeCCCcc
Q 045139          122 MKYNDFGGKQIPAFIG-SLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVN  200 (820)
Q Consensus       122 Ls~n~l~~~~~p~~i~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~l~~l~~L~~L~l~~n~  200 (820)
                      |++|.+.+. +|..+. .+++|++|+|++|.+++.+|.  +.+++|++|++++|                         .
T Consensus       100 Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n-------------------------~  151 (968)
T PLN00113        100 LSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNN-------------------------M  151 (968)
T ss_pred             CCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCC-------------------------c
Confidence            999999885 887765 899999999999999988884  45666777777666                         3


Q ss_pred             CCCCccHHHHhCCCCCCCEEEcCCCCCCCCCccccccccCCcCCccEEECcCCCCCCchhhhhhccCCCCcEEEccCCcc
Q 045139          201 LGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSSNKL  280 (820)
Q Consensus       201 l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~Ls~n~l  280 (820)
                      +.+  .+|..++++++|++|++++|.+.+..|   ..+.++ ++|++|++++|.+++.+|..+..+. +|++|++++|.+
T Consensus       152 ~~~--~~p~~~~~l~~L~~L~L~~n~l~~~~p---~~~~~l-~~L~~L~L~~n~l~~~~p~~l~~l~-~L~~L~L~~n~l  224 (968)
T PLN00113        152 LSG--EIPNDIGSFSSLKVLDLGGNVLVGKIP---NSLTNL-TSLEFLTLASNQLVGQIPRELGQMK-SLKWIYLGYNNL  224 (968)
T ss_pred             ccc--cCChHHhcCCCCCEEECccCcccccCC---hhhhhC-cCCCeeeccCCCCcCcCChHHcCcC-CccEEECcCCcc
Confidence            322  244556666666666666666666555   344444 5555555555555555555554444 555555555555


Q ss_pred             cCCCCCCCCCCCCCCCEEECCCCCCC-CcchhhhccCCCcEEEcCCCCCCCcchhhhhhcccCCcCCccEEEcCCCCCcc
Q 045139          281 QGPIPDSAFPNPTSLSYLDLSNNQLV-SVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLNSNMLRG  359 (820)
Q Consensus       281 ~g~ip~~~l~~l~~L~~L~Ls~n~l~-~ip~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~~~~~~L~~L~L~~n~l~~  359 (820)
                      ++.+|.. ++++++|++|++++|.++ .+|..++++++|++|++++|++++..|..+..+.     +|+.|++++|.+. 
T Consensus       225 ~~~~p~~-l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~-----~L~~L~Ls~n~l~-  297 (968)
T PLN00113        225 SGEIPYE-IGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQ-----KLISLDLSDNSLS-  297 (968)
T ss_pred             CCcCChh-HhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhcc-----CcCEEECcCCeec-
Confidence            5555544 455555555555555544 4444455555555555555555444444444444     4444444444443 


Q ss_pred             cCCCCcCcCCCcEEecCCCcccEEEccCCcccccccccccCCCCCCEEecCCCcCccccCHHHhhcCCCCCEEeCcCCcc
Q 045139          360 SLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSL  439 (820)
Q Consensus       360 ~~p~~~~l~~L~~L~l~~n~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~Ls~n~l  439 (820)
                                                      +.+|..+.++++|+.|++++|.+.+.+|. .+..+++|+.|++++|.+
T Consensus       298 --------------------------------~~~p~~~~~l~~L~~L~l~~n~~~~~~~~-~~~~l~~L~~L~L~~n~l  344 (968)
T PLN00113        298 --------------------------------GEIPELVIQLQNLEILHLFSNNFTGKIPV-ALTSLPRLQVLQLWSNKF  344 (968)
T ss_pred             --------------------------------cCCChhHcCCCCCcEEECCCCccCCcCCh-hHhcCCCCCEEECcCCCC
Confidence                                            34444445555555555555555554444 345555555555555444


Q ss_pred             ccccCCCCcCccccceeecccccCCCCCchhhhcCCCccEEecCCCCccCCCCchhhccCCCcEEEEcCCCcCCCCCCcc
Q 045139          440 ILNFGSGWVPSFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGMLPDL  519 (820)
Q Consensus       440 ~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~i~~~~p~~~~~~~~~L~~L~ls~n~l~~~~p~~  519 (820)
                      .                        +.+|.++..+++|+.|++++|++.+.+|.++... ++|+.|++++|++.+.+|..
T Consensus       345 ~------------------------~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~-~~L~~L~l~~n~l~~~~p~~  399 (968)
T PLN00113        345 S------------------------GEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSS-GNLFKLILFSNSLEGEIPKS  399 (968)
T ss_pred             c------------------------CcCChHHhCCCCCcEEECCCCeeEeeCChhHhCc-CCCCEEECcCCEecccCCHH
Confidence            3                        2334444555555555555555555555555443 45666666666555554442


Q ss_pred             cccccCCCCceeccCCcCcCCCCCCCCcceEEeccCcccccccchhhccccccccEEEccCCccccccCcccccCCCCcE
Q 045139          520 SQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCSKNWQKLTV  599 (820)
Q Consensus       520 ~~~~~~l~~~l~ls~n~~~~~~p~~~~~l~~l~l~~n~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~  599 (820)
                      +..                         +.                      +|+.|++++|++++.+|..+..++.|+.
T Consensus       400 ~~~-------------------------~~----------------------~L~~L~L~~n~l~~~~p~~~~~l~~L~~  432 (968)
T PLN00113        400 LGA-------------------------CR----------------------SLRRVRLQDNSFSGELPSEFTKLPLVYF  432 (968)
T ss_pred             HhC-------------------------CC----------------------CCCEEECcCCEeeeECChhHhcCCCCCE
Confidence            221                         11                      6788889999998889999999999999


Q ss_pred             EEcCCCeeeecCCCCcccccCCcEEeccCCcccccCCcchhcCCCCCEEECCCCcCccccCcchhcCCCCccEEEcCccc
Q 045139          600 LNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNN  679 (820)
Q Consensus       600 L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~~l~~L~~L~L~~N~  679 (820)
                      |++++|++++.+|..+..+++|+.|++++|++.+.+|..+ ..++|+.|++++|++++.+|..+. .+++|+.|++++|+
T Consensus       433 L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~-~l~~L~~L~Ls~N~  510 (968)
T PLN00113        433 LDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLG-SLSELMQLKLSENK  510 (968)
T ss_pred             EECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhh-hhhccCEEECcCCc
Confidence            9999999999888888889999999999999998888765 458899999999999999998887 78999999999999


Q ss_pred             ccccCCcccCCCCCCCEEeCcCCCCccccchhccccccccccccCCcccccCCccccccCceeEEeeccccccccccCce
Q 045139          680 FHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLV  759 (820)
Q Consensus       680 l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L  759 (820)
                      +.+.+|..+..+++|++|++++|+++|.+|..+.+++.|                                         
T Consensus       511 l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L-----------------------------------------  549 (968)
T PLN00113        511 LSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVL-----------------------------------------  549 (968)
T ss_pred             ceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccC-----------------------------------------
Confidence            999999999999999999999999999999988888777                                         


Q ss_pred             EEEECCCCcCeecCC-CcccccCCCEEeCCCCccccCCcccccCCCCCCeEeCCCCc
Q 045139          760 KSIDLSSNRLYGEIP-EVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSLDLSKNM  815 (820)
Q Consensus       760 ~~LdLs~N~l~~~ip-~l~~l~~L~~L~Ls~N~l~~~ip~~l~~l~~L~~LdLs~N~  815 (820)
                      +.|||++|+++|.+| .+..+++|+.|++++|+++|.+|.. +.+..+....+.+|+
T Consensus       550 ~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~  605 (968)
T PLN00113        550 SQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNI  605 (968)
T ss_pred             CEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCc
Confidence            889999999999999 8889999999999999999999864 445556666667776



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query820
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-33
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-20
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-33
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-20
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 9e-12
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-06
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-07
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-07
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-06
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 4e-05
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 5e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 5e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 140 bits (352), Expect = 4e-33, Method: Compositional matrix adjust. Identities = 176/615 (28%), Positives = 271/615 (44%), Gaps = 101/615 (16%) Query: 287 SAFPNPTSLSYLDLSNNQL---VSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCS 343 S F SL+ LDLS N L V+ S + L+ L SN L P K+S Sbjct: 91 SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD--FPG---KVSGGL 145 Query: 344 R-DTLEILQLNSNMLRGS------LPDITLFSSLKELHLYDNM------------LDVLY 384 + ++LE+L L++N + G+ L D LK L + N L+ L Sbjct: 146 KLNSLEVLDLSANSISGANVVGWVLSDGC--GELKHLAISGNKISGDVDVSRCVNLEFLD 203 Query: 385 LNNNRFTGTLTKSIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFG 444 +++N F+ T +G S L+ LD++ N L G + A +S + L L++S N + Sbjct: 204 VSSNNFS-TGIPFLGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFV---- 257 Query: 445 SGWVPSFELNIIR---LGACKQGPQFPKWLQTQ-NKFSELDVSAAEISDTVPNWFWDLSP 500 G +P L ++ L K + P +L + + LD+S VP +F S Sbjct: 258 -GPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL 316 Query: 501 ------------------------NLYYLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANS 536 L L+LS N F+G LP+ +A +DLS+N+ Sbjct: 317 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNN 376 Query: 537 FEGPIPP-----IPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLLSGELPNCS 591 F GPI P T+ L L N F+G + E L LS N LSG +P+ Sbjct: 377 FSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSE-LVSLHLSFNYLSGTIPSSL 435 Query: 592 KNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLG 651 + KL L L N G+IP + + + +L L N GE+PS + + T L + L Sbjct: 436 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLS 495 Query: 652 HNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQC 711 +N+++G IP WIG L +L +L L +N+F G +P ++ + + LDL+ N +GT+P Sbjct: 496 NNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAA 554 Query: 712 LNNLTA-MTANKSSNAMIRY----PLRTDYYNDHALLVWKRKDSEYRNTL---------- 756 + + + AN + Y ++ + + LL ++ SE N L Sbjct: 555 MFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITS 614 Query: 757 --------------GLVKSIDLSSNRLYGEIP-EVTSLVGLISLNLSKNSLTGPIPSKIG 801 G + +D+S N L G IP E+ S+ L LNL N ++G IP ++G Sbjct: 615 RVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVG 674 Query: 802 GLTLLNSLDLSKNML 816 L LN LDLS N L Sbjct: 675 DLRGLNILDLSSNKL 689
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query820
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-161
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-100
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-92
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-71
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-73
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-60
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-45
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-44
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-60
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-56
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-53
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-43
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-57
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-54
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-48
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-46
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-50
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-47
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-35
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-40
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-34
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-28
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-36
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-27
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-28
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-13
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-22
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-12
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-17
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-27
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-26
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-21
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-20
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-17
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-16
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 6e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-07
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-10
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 6e-05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  487 bits (1257), Expect = e-161
 Identities = 190/787 (24%), Positives = 306/787 (38%), Gaps = 138/787 (17%)

Query: 41  CIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSY 100
            + RE   L+ FK  L D+   L  W +  +    C + GV+C +    VT ++L  +  
Sbjct: 9   SLYREIHQLISFKDVLPDK-NLLPDWSSNKN---PCTFDGVTCRD--DKVTSIDLSSKPL 62

Query: 101 MPLRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVP--Y 158
                 +SSSL+ L  L  L +  +   G  +  F     ++  LDLS    +G V    
Sbjct: 63  NVGFSAVSSSLLSLTGLESLFLSNSHING-SVSGF-KCSASLTSLDLSRNSLSGPVTTLT 120

Query: 159 QLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNL-GEATDWLQVVSQLPSL 217
            LG+ + L++L++S N      K+    +L+ LE + L+  ++ G       +      L
Sbjct: 121 SLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGEL 180

Query: 218 TELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYLDLSS 277
             L + G  +     S  V  S                             +L +LD+SS
Sbjct: 181 KHLAISGNKI-----SGDVDVSRCV--------------------------NLEFLDVSS 209

Query: 278 NKLQGPIPDSAFPNPTSLSYLDLSNNQLV-SVPKSFRNLCRLRALYQDSNNLTDLLPNLF 336
           N     IP     + ++L +LD+S N+L     ++      L+ L   SN     +P   
Sbjct: 210 NNFSTGIP--FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP-- 265

Query: 337 LKLSNCSRDTLEILQLNSNMLRGSLPDITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTK 396
                     L+ L L  N   G +PD  L  +          L  L L+ N F G +  
Sbjct: 266 ---LPLKS--LQYLSLAENKFTGEIPD-FLSGACD-------TLTGLDLSGNHFYGAVPP 312

Query: 397 SIGQLSQLELLDVASNSLKGMITEAHLSNLSRLTYLDLSHNSLILNFGSGWVPSFELNII 456
             G  S LE L ++SN+  G +    L  +  L  LDLS N                   
Sbjct: 313 FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF----------------- 355

Query: 457 RLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLYYLNLSHNHFTGML 516
                                          S  +P    +LS +L  L+LS N+F+G +
Sbjct: 356 -------------------------------SGELPESLTNLSASLLTLDLSSNNFSGPI 384

Query: 517 P-DLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRY 575
             +L Q       E+ L  N F G IPP                     L   S      
Sbjct: 385 LPNLCQNPKNTLQELYLQNNGFTGKIPP--------------------TLSNCS--ELVS 422

Query: 576 LDLSDNLLSGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGEL 635
           L LS N LSG +P+   +  KL  L L  N   G+IP  + +   + +L L  N   GE+
Sbjct: 423 LHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEI 482

Query: 636 PSSVKSFTQLTVLDLGHNKISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQ 695
           PS + + T L  + L +N+++G IP WIG  L +L +L L +N+F G +P ++   + + 
Sbjct: 483 PSGLSNCTNLNWISLSNNRLTGEIPKWIG-RLENLAILKLSNNSFSGNIPAELGDCRSLI 541

Query: 696 VLDLSQNNISGTVPQCLNNLTAMTANKSSNAMIRYPLR-----TDYYNDHALLVWKRKDS 750
            LDL+ N  +GT+P  +   +   A           ++      + +    LL ++   S
Sbjct: 542 WLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRS 601

Query: 751 EYRNTLGLVKSIDLSSNRLYGEIP-EVTSLVGLISLNLSKNSLTGPIPSKIGGLTLLNSL 809
           E  N L      +++S    G       +   ++ L++S N L+G IP +IG +  L  L
Sbjct: 602 EQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFIL 661

Query: 810 DLSKNML 816
           +L  N +
Sbjct: 662 NLGHNDI 668


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query820
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.33
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.33
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.28
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.1
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.02
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.54
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.46
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.86
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.9
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.86
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.16
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-86  Score=792.63  Aligned_cols=674  Identities=28%  Similarity=0.402  Sum_probs=468.2

Q ss_pred             cCCHHHHHHHHHhhccCCCCCCCCCCCCCCCCCCCCcccCceEecCCCCcEEEEEcCCCCCCCCccc---ccccccCCCC
Q 045139           40 KCIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSNQTGHVTMLNLQFRSYMPLRGN---ISSSLIGLQH  116 (820)
Q Consensus        40 ~~~~~~~~~l~~~~~~~~~~~~~~~~W~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~~~~l~g~---i~~~l~~l~~  116 (820)
                      .+.++|++||++||+++.||. .+++|.   .+.+||.|.||+|+  +|||++|+|++   .++.|.   +|++++++++
T Consensus         8 ~~~~~~~~all~~k~~~~~~~-~l~~W~---~~~~~C~w~gv~C~--~~~v~~L~L~~---~~l~g~~~~l~~~l~~L~~   78 (768)
T 3rgz_A            8 QSLYREIHQLISFKDVLPDKN-LLPDWS---SNKNPCTFDGVTCR--DDKVTSIDLSS---KPLNVGFSAVSSSLLSLTG   78 (768)
T ss_dssp             CCHHHHHHHHHHHHTTCSCTT-SSTTCC---TTSCGGGSTTEEEE--TTEEEEEECTT---SCCCEEHHHHHHHTTTCTT
T ss_pred             cCCHHHHHHHHHHHhhCCCcc-cccCCC---CCCCCcCCcceEEC--CCcEEEEECCC---CCcCCccCccChhHhccCc
Confidence            356789999999999999988 899997   47899999999998  68999999999   889998   9999999999


Q ss_pred             CCEEECcCCCCCCcccCccccCCCCCCEEeccCCCCCCCCCc--cCCCCCCCcEEeCCCCccccccchh-hccCCCCCCe
Q 045139          117 LNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPY--QLGNLTSLQYLDLSFNFDMLSKKLE-WLSQLSFLEY  193 (820)
Q Consensus       117 L~~L~Ls~n~l~~~~~p~~i~~l~~L~~L~Ls~n~l~~~~p~--~l~~l~~L~~L~Ls~n~~~~~~~~~-~l~~l~~L~~  193 (820)
                      |+.++++.+.+..  +|+.++++++|++|+|++|.++|.+|.  .++++++|++|++++|. .....+. .+.++++|++
T Consensus        79 L~~l~~~~~~~~~--l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~-l~~~~~~~~~~~l~~L~~  155 (768)
T 3rgz_A           79 LESLFLSNSHING--SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNT-LDFPGKVSGGLKLNSLEV  155 (768)
T ss_dssp             CCEEECTTSCEEE--CCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSE-EECCSSCCSCCCCTTCSE
T ss_pred             ccccCCcCCCcCC--CchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCc-cCCcCCHHHhccCCCCCE
Confidence            9999999998743  778999999999999999999999998  99999999999999993 2222222 3367888888


Q ss_pred             eeCCCccCCCCccHHHH---hCCCCCCCEEEcCCCCCCCCCccccccccCCcCCccEEECcCCCCCCchhhhhhccCCCC
Q 045139          194 VRLNQVNLGEATDWLQV---VSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSL  270 (820)
Q Consensus       194 L~l~~n~l~~~~~~~~~---l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L  270 (820)
                      |++++|.+.+.  .+..   +.++++|++|++++|.+++..+     +..+ ++|++|++++|.+++.+|. +.... +|
T Consensus       156 L~Ls~n~l~~~--~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~-----~~~l-~~L~~L~Ls~n~l~~~~~~-l~~l~-~L  225 (768)
T 3rgz_A          156 LDLSANSISGA--NVVGWVLSDGCGELKHLAISGNKISGDVD-----VSRC-VNLEFLDVSSNNFSTGIPF-LGDCS-AL  225 (768)
T ss_dssp             EECCSSCCEEE--THHHHHHTTCCTTCCEEECCSSEEESCCB-----CTTC-TTCCEEECCSSCCCSCCCB-CTTCC-SC
T ss_pred             EECCCCccCCc--CChhhhhhccCCCCCEEECCCCcccccCC-----cccC-CcCCEEECcCCcCCCCCcc-cccCC-CC
Confidence            88888887763  3333   6778888888888887776654     2344 6777777777777666655 44444 67


Q ss_pred             cEEEccCCcccCCCCCCCCCCCCCCCEEECCCCCCC-CcchhhhccCCCcEEEcCCCCCCCcchhhhhhc-ccCCcCCcc
Q 045139          271 VYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLV-SVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKL-SNCSRDTLE  348 (820)
Q Consensus       271 ~~L~Ls~n~l~g~ip~~~l~~l~~L~~L~Ls~n~l~-~ip~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l-~~~~~~~L~  348 (820)
                      ++|++++|.+++.+|.. ++.+++|++|++++|+++ .+|..  .+++|++|++++|++++.+|..+... +     +|+
T Consensus       226 ~~L~Ls~n~l~~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~-----~L~  297 (768)
T 3rgz_A          226 QHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACD-----TLT  297 (768)
T ss_dssp             CEEECCSSCCCSCHHHH-TTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCT-----TCS
T ss_pred             CEEECcCCcCCCcccHH-HhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcC-----cCC
Confidence            77777777776666655 666777777777777666 34432  56667777777776666666655543 4     666


Q ss_pred             EEEcCCCCCcccCCC-CcCcCCCcEEecCCCcccEEEccCCccccccccc-ccCCCCCCEEecCCCcCccccCHHHhhcC
Q 045139          349 ILQLNSNMLRGSLPD-ITLFSSLKELHLYDNMLDVLYLNNNRFTGTLTKS-IGQLSQLELLDVASNSLKGMITEAHLSNL  426 (820)
Q Consensus       349 ~L~L~~n~l~~~~p~-~~~l~~L~~L~l~~n~L~~L~L~~n~l~~~~~~~-l~~l~~L~~L~L~~n~l~~~~~~~~l~~l  426 (820)
                      +|++++|.+.+.+|. ++.+++|++|+          +++|.++|.+|.. +.++++|++|++++|.+++.+|. .+.++
T Consensus       298 ~L~Ls~n~l~~~~p~~~~~l~~L~~L~----------L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~-~l~~l  366 (768)
T 3rgz_A          298 GLDLSGNHFYGAVPPFFGSCSLLESLA----------LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE-SLTNL  366 (768)
T ss_dssp             EEECCSSEEEECCCGGGGGCTTCCEEE----------CCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCT-THHHH
T ss_pred             EEECcCCcCCCccchHHhcCCCccEEE----------CCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccH-HHHhh
Confidence            777777766666665 66666666543          3345555555544 66666666777766666665665 45555


Q ss_pred             C-CCCEEeCcCCccccccCCCCcC--ccccceeecccccCCCCCchhhhcCCCccEEecCCCCccCCCCchhhccCCCcE
Q 045139          427 S-RLTYLDLSHNSLILNFGSGWVP--SFELNIIRLGACKQGPQFPKWLQTQNKFSELDVSAAEISDTVPNWFWDLSPNLY  503 (820)
Q Consensus       427 ~-~L~~L~Ls~n~l~~~~~~~~~~--~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~i~~~~p~~~~~~~~~L~  503 (820)
                      + +|++|++++|.+.+..+..+..  ...|+.|++++|.+.+.+|.++..+++|++|++++|.+++.+|..+..+ ++|+
T Consensus       367 ~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l-~~L~  445 (768)
T 3rgz_A          367 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL-SKLR  445 (768)
T ss_dssp             TTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGC-TTCC
T ss_pred             hcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcC-CCCC
Confidence            4 6666666666666666655544  4556666666666666666666666666666666666666666665554 4666


Q ss_pred             EEEcCCCcCCCCCCcccccccCCCCceeccCCcCcCCCCCCCCcceEEeccCcccccccchhhccccccccEEEccCCcc
Q 045139          504 YLNLSHNHFTGMLPDLSQKFTAYPPEIDLSANSFEGPIPPIPLTVTSLILFKNMFSGSLSFLCQISDEHFRYLDLSDNLL  583 (820)
Q Consensus       504 ~L~ls~n~l~~~~p~~~~~~~~l~~~l~ls~n~~~~~~p~~~~~l~~l~l~~n~~~~~~~~~~~~~~~~L~~L~Ls~n~l  583 (820)
                      +|++++|++++.+|..+..++.+ +.+++++|+++|.+|..+..+.                      +|++|++++|++
T Consensus       446 ~L~L~~n~l~~~~p~~~~~l~~L-~~L~L~~N~l~~~~p~~l~~l~----------------------~L~~L~L~~N~l  502 (768)
T 3rgz_A          446 DLKLWLNMLEGEIPQELMYVKTL-ETLILDFNDLTGEIPSGLSNCT----------------------NLNWISLSNNRL  502 (768)
T ss_dssp             EEECCSSCCCSCCCGGGGGCTTC-CEEECCSSCCCSCCCGGGGGCT----------------------TCCEEECCSSCC
T ss_pred             EEECCCCcccCcCCHHHcCCCCc-eEEEecCCcccCcCCHHHhcCC----------------------CCCEEEccCCcc
Confidence            66666666666666655555555 5666666666655554433332                      566666666666


Q ss_pred             ccccCcccccCCCCcEEEcCCCeeeecCCCCcccccCCcEEeccCCcccccCCcchhcCCCCCEEECCCC----------
Q 045139          584 SGELPNCSKNWQKLTVLNLANNKFSGKIPDSMDFNCMMLSLHLRNNSFIGELPSSVKSFTQLTVLDLGHN----------  653 (820)
Q Consensus       584 ~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N----------  653 (820)
                      ++.+|..++.+++|++|++++|++++.+|..++.+++|++|++++|+++|.+|..+..+..+..+++..+          
T Consensus       503 ~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~  582 (768)
T 3rgz_A          503 TGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDG  582 (768)
T ss_dssp             CSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCS
T ss_pred             CCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccc
Confidence            6666666666666666666666666666666666666666666666666666665555444443333221          


Q ss_pred             ------------cCccccCcchhcCCCCccEEEcCcccccccCCcccCCCCCCCEEeCcCCCCccccchhcccccccccc
Q 045139          654 ------------KISGIIPAWIGDSLPDLVVLSLRSNNFHGRVPVQVCHLQRIQVLDLSQNNISGTVPQCLNNLTAMTAN  721 (820)
Q Consensus       654 ------------~l~~~~p~~l~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~~  721 (820)
                                  .+.|..|..+. .++.++.++++.|.+.|.+|..+..+++|+.||+++|+++|.+|.++++++.|   
T Consensus       583 ~~~~~~~~~~~~~~~~~~~~~~~-~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L---  658 (768)
T 3rgz_A          583 MKKECHGAGNLLEFQGIRSEQLN-RLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYL---  658 (768)
T ss_dssp             CCTTCCSSEEEEECTTCCGGGGG-GGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTC---
T ss_pred             ccccccccccccccccccchhhh-ccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccC---
Confidence                        12223333333 34445555666677777777777777888888888888888888777777766   


Q ss_pred             ccCCcccccCCccccccCceeEEeeccccccccccCceEEEECCCCcCeecCC-CcccccCCCEEeCCCCccccCCcccc
Q 045139          722 KSSNAMIRYPLRTDYYNDHALLVWKRKDSEYRNTLGLVKSIDLSSNRLYGEIP-EVTSLVGLISLNLSKNSLTGPIPSKI  800 (820)
Q Consensus       722 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~ip-~l~~l~~L~~L~Ls~N~l~~~ip~~l  800 (820)
                                                            +.|||++|+++|.|| .++++++|++||||+|+++|.+|..+
T Consensus       659 --------------------------------------~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l  700 (768)
T 3rgz_A          659 --------------------------------------FILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAM  700 (768)
T ss_dssp             --------------------------------------CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGG
T ss_pred             --------------------------------------CEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHH
Confidence                                                  678888888887888 77788888888888888888888878


Q ss_pred             cCCCCCCeEeCCCCcCcccC
Q 045139          801 GGLTLLNSLDLSKNMLMRAT  820 (820)
Q Consensus       801 ~~l~~L~~LdLs~N~l~g~i  820 (820)
                      +++++|++||+|+|+|+|+|
T Consensus       701 ~~l~~L~~L~ls~N~l~g~i  720 (768)
T 3rgz_A          701 SALTMLTEIDLSNNNLSGPI  720 (768)
T ss_dssp             GGCCCCSEEECCSSEEEEEC
T ss_pred             hCCCCCCEEECcCCcccccC
Confidence            77888888888888887765



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 820
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 85.2 bits (209), Expect = 2e-18
 Identities = 75/324 (23%), Positives = 112/324 (34%), Gaps = 34/324 (10%)

Query: 41  CIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCC--KWRGVSCSN--QTGHVTMLNLQ 96
           C  +++QALL  K+ L +    LSSW       DCC   W GV C    QT  V  L+L 
Sbjct: 3   CNPQDKQALLQIKKDLGNP-TTLSSWLPTT---DCCNRTWLGVLCDTDTQTYRVNNLDL- 57

Query: 97  FRSYMPLRGN--ISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTG 154
             S + L     I SSL  L +LN+L +   +     IP  I  L  + +L +++   +G
Sbjct: 58  --SGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSG 115

Query: 155 RVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEYVRLNQVNLGEATDWLQVVSQL 214
            +P  L  + +L  LD S+N    +      S  + +          G   D     S+L
Sbjct: 116 AIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKL 175

Query: 215 ---------------PSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSV 259
                          P             S       +            + L   S + 
Sbjct: 176 FTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF 235

Query: 260 YYWLFNSSSSLVYLDLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLR 319
                  S +L  LDL +N++ G +P         L  L++S N L        NL R  
Sbjct: 236 DLGKVGLSKNLNGLDLRNNRIYGTLPQG-LTQLKFLHSLNVSFNNLCGEIPQGGNLQRFD 294

Query: 320 ALYQDSNNLTDLLPNLFLKLSNCS 343
                +N      P     L  C+
Sbjct: 295 VSAYANNKCLCGSP-----LPACT 313


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query820
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.54
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.73
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.64
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=3.8e-39  Score=340.33  Aligned_cols=291  Identities=28%  Similarity=0.410  Sum_probs=236.1

Q ss_pred             CCHHHHHHHHHhhccCCCCCCCCCCCCCCCCCCCCcc--cCceEecCCC--CcEEEEEcCCCCCCCCcc--cccccccCC
Q 045139           41 CIERERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCK--WRGVSCSNQT--GHVTMLNLQFRSYMPLRG--NISSSLIGL  114 (820)
Q Consensus        41 ~~~~~~~~l~~~~~~~~~~~~~~~~W~~~~~~~~~c~--w~gv~c~~~~--~~v~~L~L~~~~~~~l~g--~i~~~l~~l  114 (820)
                      |.++|++||++||+++.+|. .+++|.   .++|||.  |.||+|++.+  +||+.|+|++   +.++|  .+|++++++
T Consensus         3 c~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~---~~l~g~~~lp~~l~~L   75 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG---LNLPKPYPIPSSLANL   75 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEEC---CCCSSCEECCGGGGGC
T ss_pred             CCHHHHHHHHHHHHHCCCCC-cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCC---CCCCCCCCCChHHhcC
Confidence            99999999999999998874 689997   4789994  9999998643  4899999999   78887  588999999


Q ss_pred             CCCCEEECcC-CCCCCcccCccccCCCCCCEEeccCCCCCCCCCccCCCCCCCcEEeCCCCccccccchhhccCCCCCCe
Q 045139          115 QHLNYLNMKY-NDFGGKQIPAFIGSLKNIRHLDLSNAGFTGRVPYQLGNLTSLQYLDLSFNFDMLSKKLEWLSQLSFLEY  193 (820)
Q Consensus       115 ~~L~~L~Ls~-n~l~~~~~p~~i~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~~~~~~~~~~l~~l~~L~~  193 (820)
                      ++|++|||++ |++.|. +|+.|+++++|++|+|++|++.+..|..+..+.+|+++++++|.                  
T Consensus        76 ~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~------------------  136 (313)
T d1ogqa_          76 PYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNA------------------  136 (313)
T ss_dssp             TTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSE------------------
T ss_pred             ccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhccccccccc------------------
Confidence            9999999987 889886 99999999999999999999998888888899999999998881                  


Q ss_pred             eeCCCccCCCCccHHHHhCCCCCCCEEEcCCCCCCCCCccccccccCCcCCccEEECcCCCCCCchhhhhhccCCCCcEE
Q 045139          194 VRLNQVNLGEATDWLQVVSQLPSLTELQLRGCNLPSVIASSSVSFSNSSRSLAHLDLSLNDVSNSVYYWLFNSSSSLVYL  273 (820)
Q Consensus       194 L~l~~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L  273 (820)
                             +..  .+|..++++++++++++++|.+.+.+|   ..+..+...++.++++.|++++..|..+...  ....+
T Consensus       137 -------~~~--~~p~~l~~l~~L~~l~l~~n~l~~~ip---~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l--~~~~l  202 (313)
T d1ogqa_         137 -------LSG--TLPPSISSLPNLVGITFDGNRISGAIP---DSYGSFSKLFTSMTISRNRLTGKIPPTFANL--NLAFV  202 (313)
T ss_dssp             -------EES--CCCGGGGGCTTCCEEECCSSCCEEECC---GGGGCCCTTCCEEECCSSEEEEECCGGGGGC--CCSEE
T ss_pred             -------ccc--cCchhhccCcccceeeccccccccccc---ccccccccccccccccccccccccccccccc--ccccc
Confidence                   111  244566777777777777777777777   4555553345788888888887777766554  45678


Q ss_pred             EccCCcccCCCCCCCCCCCCCCCEEECCCCCCCCcchhhhccCCCcEEEcCCCCCCCcchhhhhhcccCCcCCccEEEcC
Q 045139          274 DLSSNKLQGPIPDSAFPNPTSLSYLDLSNNQLVSVPKSFRNLCRLRALYQDSNNLTDLLPNLFLKLSNCSRDTLEILQLN  353 (820)
Q Consensus       274 ~Ls~n~l~g~ip~~~l~~l~~L~~L~Ls~n~l~~ip~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~~~~~~L~~L~L~  353 (820)
                      +++.+...|.+|.. +..+++++.+++++|.++..++.++.+++|++|++++|++++.+|..|++++     +|++|+|+
T Consensus       203 ~l~~~~~~~~~~~~-~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~-----~L~~L~Ls  276 (313)
T d1ogqa_         203 DLSRNMLEGDASVL-FGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLK-----FLHSLNVS  276 (313)
T ss_dssp             ECCSSEEEECCGGG-CCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCT-----TCCEEECC
T ss_pred             cccccccccccccc-ccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCC-----CCCEEECc
Confidence            88888888777776 7788888888888888886666788888888888888888888888888887     78888888


Q ss_pred             CCCCcccCCCCcCcCCCcEEecCC
Q 045139          354 SNMLRGSLPDITLFSSLKELHLYD  377 (820)
Q Consensus       354 ~n~l~~~~p~~~~l~~L~~L~l~~  377 (820)
                      +|+++|.+|.++.+++|+.+++++
T Consensus       277 ~N~l~g~iP~~~~L~~L~~l~l~~  300 (313)
T d1ogqa_         277 FNNLCGEIPQGGNLQRFDVSAYAN  300 (313)
T ss_dssp             SSEEEEECCCSTTGGGSCGGGTCS
T ss_pred             CCcccccCCCcccCCCCCHHHhCC
Confidence            888888887766666666554443



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure