Citrus Sinensis ID: 045170

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
KGWPSYQSQYWRVQFNLDLLGEEGISNEILNVTYFGCSSNPSTFSVVSSVIENEFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYMLICYSCA
ccHHHHHHHHHHHHHHcHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHHHcHHccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccEEEEHHHHHHHccccccccccccccccccc
cHHHHHHcHHHHHHHHHHHHHccccccccEEEEEccccccccHHHEHHHHccccEEEEEcccccccHHHHHHHcHHHHHHcccccEEEEEccccccccccccccEEEEEcHHHHHHHHccccHHccccccccccc
KGWPSYQSQYWRVQFNLDllgeegisneiLNVTyfgcssnpstfSVVSSVIENEFPFYLNDLLGNDFNMLFQGLSSFAERYkdlslftvgapgsfhgwlfptnslhlvHSSYGahwlskmrLPILKYMLICYSCA
KGWPSYQSQYWRVQFNLDLLGEEGISNEILNVTYFGCSSNPSTFSVVSSVIENEFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYMLICYSCA
KGWPSYQSQYWRVQFNLDLLGEEGISNEILNVTYFGCssnpstfsvvssvIENEFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYMLICYSCA
*****YQSQYWRVQFNLDLLGEEGISNEILNVTYFGCSSNPSTFSVVSSVIENEFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYMLICYSC*
*GWPSYQSQYWRV***L**LGEEGISNEILNVTYFGCSSNPSTFSVVSSVIENEFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYM**CYS**
KGWPSYQSQYWRVQFNLDLLGEEGISNEILNVTYFGCSSNPSTFSVVSSVIENEFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYMLICYSCA
KGW*SYQSQYWRVQFNLDLLGEEGISNEILNVTYFGCSSNPSTFSVVSSVIENEFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYM*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KGWPSYQSQYWRVQFNLDLLGEEGISNEILNVTYFGCSSNPSTFSVVSSVIENEFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYMLICYSCA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
Q9FZN8 369 Caffeine synthase 1 OS=Ca N/A no 0.681 0.249 0.467 2e-21
Q68CM3 365 Probable caffeine synthas N/A no 0.681 0.252 0.467 6e-21
Q9FKD0 362 Probable S-adenosylmethio no no 0.844 0.314 0.360 8e-16
Q9FKC8 362 Probable S-adenosylmethio no no 0.829 0.309 0.350 2e-14
Q9LS10 359 Probable S-adenosylmethio no no 0.637 0.239 0.392 3e-14
Q9SPV4 359 Salicylate O-methyltransf N/A no 0.688 0.259 0.394 4e-14
Q9AVJ9 378 Monomethylxanthine methyl N/A no 0.696 0.248 0.347 6e-13
Q8H0D2 384 3,7-dimethylxanthine N-me N/A no 0.696 0.244 0.347 7e-13
Q84PP7 384 Monomethylxanthine methyl N/A no 0.696 0.244 0.347 8e-13
Q9FKR0 361 Probable S-adenosylmethio no no 0.733 0.274 0.362 9e-13
>sp|Q9FZN8|TCS1_CAMSI Caffeine synthase 1 OS=Camellia sinensis GN=TCS1 PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 68/107 (63%), Gaps = 15/107 (14%)

Query: 28  EILNVTYFGCSSNPSTFSVVSSV---IEN----------EFPFYLNDLLGNDFNMLFQGL 74
           + LN    GC++ P+TF+V+S++   +E           E   YLNDL GNDFN LF+GL
Sbjct: 57  QALNAADLGCAAGPNTFAVISTIKRMMEKKCRELNCQTLELQVYLNDLFGNDFNTLFKGL 116

Query: 75  SS--FAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSK 119
           SS     + +++  + +G PGSFHG LFP NSLHLVHSSY  HWL++
Sbjct: 117 SSEVIGNKCEEVPCYVMGVPGSFHGRLFPRNSLHLVHSSYSVHWLTQ 163
Involved in the biosynthesis of caffeine. Catalyzes the conversion of 7-methylxanthine (7mX) to theobromine and of theobromine to caffeine. Has 3-N- and 1-N-methylation activity.
Camellia sinensis (taxid: 4442)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 6EC: 0
>sp|Q68CM3|TCS2_CAMSI Probable caffeine synthase 2 OS=Camellia sinensis GN=TCS2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKD0|MT797_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1 Back     alignment and function description
>sp|Q9FKC8|MT799_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2 Back     alignment and function description
>sp|Q9LS10|MT810_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38100 OS=Arabidopsis thaliana GN=At5g38100 PE=2 SV=1 Back     alignment and function description
>sp|Q9SPV4|SAMT_CLABR Salicylate O-methyltransferase OS=Clarkia breweri GN=SAMT PE=1 SV=1 Back     alignment and function description
>sp|Q9AVJ9|MXMT1_COFAR Monomethylxanthine methyltransferase 1 OS=Coffea arabica GN=MXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8H0D2|DXMT1_COFAR 3,7-dimethylxanthine N-methyltransferase OS=Coffea arabica GN=DXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q84PP7|MXMT2_COFAR Monomethylxanthine methyltransferase 2 OS=Coffea arabica GN=MXMT2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FKR0|MT878_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38780 OS=Arabidopsis thaliana GN=At5g38780 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
87887929 363 caffeine synthase [Theobroma cacao] 0.740 0.275 0.548 5e-28
215272189 366 theobromine synthase [Camellia lutchuens 0.681 0.251 0.490 2e-20
145952324 369 caffeine synthase [Camellia sinensis] gi 0.681 0.249 0.476 4e-20
46242826217 caffeine synthase 1 [Camellia sinensis v 0.681 0.423 0.476 6e-20
215272185 366 theobromine synthase [Camellia granthami 0.681 0.251 0.481 6e-20
59611829 365 caffeine synthase [Camellia sinensis] 0.681 0.252 0.467 2e-19
75173459 369 RecName: Full=Caffeine synthase 1 gi|996 0.681 0.249 0.467 2e-19
215272187 364 theobromine synthase [Camellia kissii] 0.681 0.252 0.485 2e-19
87887946 365 theobromine synthase [Camellia ptilophyl 0.681 0.252 0.467 3e-19
87887941 365 theobromine synthase [Camellia ptilophyl 0.681 0.252 0.467 3e-19
>gi|87887929|dbj|BAE79730.1| caffeine synthase [Theobroma cacao] Back     alignment and taxonomy information
 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 79/113 (69%), Gaps = 13/113 (11%)

Query: 21  GEEGISNEILNVTYFGCSSNPSTFSVVSSVIEN-------------EFPFYLNDLLGNDF 67
           G    S ++LNV   GCSS P+TF+V+S+VIE+             E  FYLNDL+GNDF
Sbjct: 46  GRNSCSYQVLNVADLGCSSGPNTFTVMSTVIESTRDKCSELNWQMPEIQFYLNDLVGNDF 105

Query: 68  NMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKM 120
           N LF+GLS   ++YK++S F +GAPGSFHG LFP NS+HL+HSSYG  WLSK+
Sbjct: 106 NTLFKGLSVIQDKYKNVSCFAMGAPGSFHGRLFPQNSMHLIHSSYGVQWLSKV 158

Source: Theobroma cacao

Species: Theobroma cacao

Genus: Theobroma

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|215272189|dbj|BAG84616.1| theobromine synthase [Camellia lutchuensis] Back     alignment and taxonomy information
>gi|145952324|gb|ABP98983.1| caffeine synthase [Camellia sinensis] gi|411012944|gb|AFV99128.1| caffeine synthase 1 [Camellia sinensis] Back     alignment and taxonomy information
>gi|46242826|gb|AAS83524.1| caffeine synthase 1 [Camellia sinensis var. sinensis] Back     alignment and taxonomy information
>gi|215272185|dbj|BAG84614.1| theobromine synthase [Camellia granthamiana] Back     alignment and taxonomy information
>gi|59611829|gb|AAW88351.1| caffeine synthase [Camellia sinensis] Back     alignment and taxonomy information
>gi|75173459|sp|Q9FZN8.1|TCS1_CAMSI RecName: Full=Caffeine synthase 1 gi|9967143|dbj|BAB12278.1| caffeine synthase [Camellia sinensis] Back     alignment and taxonomy information
>gi|215272187|dbj|BAG84615.1| theobromine synthase [Camellia kissii] Back     alignment and taxonomy information
>gi|87887946|dbj|BAE79733.1| theobromine synthase [Camellia ptilophylla] Back     alignment and taxonomy information
>gi|87887941|dbj|BAE79732.1| theobromine synthase [Camellia ptilophylla] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2154845 354 AT5G66430 [Arabidopsis thalian 0.459 0.175 0.555 3.4e-12
TAIR|locus:2115400 371 AT4G36470 [Arabidopsis thalian 0.496 0.180 0.472 3.9e-12
TAIR|locus:2053458 359 AT2G14060 [Arabidopsis thalian 0.496 0.186 0.485 2.1e-11
TAIR|locus:2179929 415 NAMT1 [Arabidopsis thaliana (t 0.459 0.149 0.531 3.8e-11
TAIR|locus:2080747 379 BSMT1 [Arabidopsis thaliana (t 0.459 0.163 0.523 5.1e-11
TAIR|locus:2144461 359 AT5G38100 [Arabidopsis thalian 0.466 0.175 0.477 7.5e-11
TAIR|locus:2095572 368 AT3G21950 [Arabidopsis thalian 0.459 0.168 0.507 1.3e-10
TAIR|locus:2166640 361 AT5G38780 [Arabidopsis thalian 0.466 0.174 0.447 2.1e-10
TAIR|locus:2144466 368 AT5G38020 [Arabidopsis thalian 0.459 0.168 0.507 7.7e-10
TAIR|locus:2179969 385 AT5G04380 "AT5G04380" [Arabido 0.459 0.161 0.460 8.1e-09
TAIR|locus:2154845 AT5G66430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 169 (64.5 bits), Expect = 3.4e-12, P = 3.4e-12
 Identities = 35/63 (55%), Positives = 40/63 (63%)

Query:    59 LNDLLGNDFNMLFQGLSSFAERYKDLSL-FTVGAPGSFHGWLFPTNSLHLVHSSYGAHWL 117
             LNDL  NDFN  F+ +  F +R K   L F  G PGSF+  LFP  SLH VHSSY  HWL
Sbjct:    87 LNDLPDNDFNTTFKFVPFFNKRVKSKRLCFVSGVPGSFYSRLFPRKSLHFVHSSYSLHWL 146

Query:   118 SKM 120
             SK+
Sbjct:   147 SKV 149
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016114 "terpenoid biosynthetic process" evidence=RCA
TAIR|locus:2115400 AT4G36470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053458 AT2G14060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179929 NAMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080747 BSMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144461 AT5G38100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095572 AT3G21950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166640 AT5G38780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144466 AT5G38020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179969 AT5G04380 "AT5G04380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
pfam03492 331 pfam03492, Methyltransf_7, SAM dependent carboxyl 6e-32
PLN02668 386 PLN02668, PLN02668, indole-3-acetate carboxyl meth 3e-14
>gnl|CDD|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase Back     alignment and domain information 
 Score =  114 bits (288), Expect = 6e-32
 Identities = 51/117 (43%), Positives = 63/117 (53%), Gaps = 17/117 (14%)

Query: 17  LDLLGEEGISNEILNVTYFGCSSNPSTFSVVSSVIEN--------------EFPFYLNDL 62
            +LL      N  + +   GCSS P+TF  VS++I+               EF  + NDL
Sbjct: 6   SELLLRNLFPN-SIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKENILEPPEFQVFFNDL 64

Query: 63  LGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSK 119
             NDFN LF+ L  F +  K  S F  G PGSF+G LFP NSLH VHSSY  HWLS+
Sbjct: 65  PSNDFNTLFKLLPPFQK--KKRSYFVSGVPGSFYGRLFPRNSLHFVHSSYSLHWLSQ 119

This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331
>gnl|CDD|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 100.0
PLN02668 386 indole-3-acetate carboxyl methyltransferase 100.0
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 97.37
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 96.86
PRK06202232 hypothetical protein; Provisional 96.83
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 96.61
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.33
PRK10258 251 biotin biosynthesis protein BioC; Provisional 96.08
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 95.87
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 95.81
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 95.63
TIGR00740239 methyltransferase, putative. A simple BLAST search 95.43
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 95.31
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 95.12
PRK05785226 hypothetical protein; Provisional 94.9
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 94.84
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 94.77
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 94.73
KOG2940 325 consensus Predicted methyltransferase [General fun 94.66
PRK08317 241 hypothetical protein; Provisional 94.34
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 94.17
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 94.02
PLN02490 340 MPBQ/MSBQ methyltransferase 93.99
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 93.97
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 93.89
PRK12335287 tellurite resistance protein TehB; Provisional 93.58
PLN02336 475 phosphoethanolamine N-methyltransferase 93.52
PRK11207197 tellurite resistance protein TehB; Provisional 93.47
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 93.42
PLN02233261 ubiquinone biosynthesis methyltransferase 93.37
PRK06922 677 hypothetical protein; Provisional 93.27
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 93.26
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 92.76
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 92.59
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 92.26
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 91.98
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 91.86
PLN02244 340 tocopherol O-methyltransferase 91.81
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 91.47
PLN02336 475 phosphoethanolamine N-methyltransferase 91.2
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 90.66
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 89.97
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 89.82
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 89.65
PTZ00146293 fibrillarin; Provisional 89.44
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 89.2
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 88.77
TIGR00452314 methyltransferase, putative. Known examples to dat 88.69
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 88.43
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 88.26
KOG3010 261 consensus Methyltransferase [General function pred 88.05
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 87.51
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 86.83
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 86.75
TIGR03438 301 probable methyltransferase. This model represents 86.2
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 85.4
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 85.39
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 84.13
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 83.55
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 83.24
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 81.58
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 80.07
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information 
Probab=100.00  E-value=3.5e-46  Score=313.75  Aligned_cols=102  Identities=43%  Similarity=0.787  Sum_probs=84.6

Q ss_pred             CCCcceEEEeecCCCCcccHHHHHHhhc--------------CceeEEecCCCCCchHHHhhcchhhhhhcc-CCCEEEE
Q 045170           25 ISNEILNVTYFGCSSNPSTFSVVSSVIE--------------NEFPFYLNDLLGNDFNMLFQGLSSFAERYK-DLSLFTV   89 (135)
Q Consensus        25 ~~~~~~~IaDlGCS~G~NSl~~i~~iI~--------------peiqv~~nDLP~NDFntLF~~l~~~~~~~~-~~~~f~~   89 (135)
                      ..+++++|||||||+|+||+.+++.||+              |||||||||||+||||+||++|+.+.++++ .++||++
T Consensus        13 ~~~~~~~iaD~GcS~G~Nsl~~~~~ii~~i~~~~~~~~~~~~~e~~v~~nDlP~NDFn~lF~~l~~~~~~~~~~~~~f~~   92 (334)
T PF03492_consen   13 NNPKPFRIADLGCSSGPNSLLAVSNIIDAIRERCRSSNNQPPPEFQVFFNDLPSNDFNTLFKSLPSFQQSLKKFRNYFVS   92 (334)
T ss_dssp             TTTTEEEEEEES--SSHHHHHHHHHHHHHHHHHHHCTT-SS--EEEEEEEE-TTS-HHHHHHCHHHHHHHHHHTTSEEEE
T ss_pred             CCCCceEEEecCCCCCccHHHHHHHHHHHHHHHhhhhcCCCCCeEEEEeCCCCCccHHHHHHhChhhhhccCCCceEEEE
Confidence            5789999999999999999999999998              579999999999999999999999987765 4899999


Q ss_pred             ecCCcccccccCCCceeeEecchhhhccccCCccccc
Q 045170           90 GAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILK  126 (135)
Q Consensus        90 ~vpgSFY~rLfP~~Svh~~~Ss~alHWLS~~P~~l~d  126 (135)
                      |||||||+||||++||||+||++|||||||+|+++.|
T Consensus        93 gvpgSFy~rLfP~~Svh~~~Ss~alHWLS~vP~~l~~  129 (334)
T PF03492_consen   93 GVPGSFYGRLFPSNSVHFGHSSYALHWLSQVPEELVD  129 (334)
T ss_dssp             EEES-TTS--S-TT-EEEEEEES-TTB-SSS-CCCCT
T ss_pred             ecCchhhhccCCCCceEEEEEechhhhcccCCccccc
Confidence            9999999999999999999999999999999999999

Caffeine is synthesized through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyses the second step to produce theobromine [].; GO: 0008168 methyltransferase activity; PDB: 2EFJ_A 1M6E_X 2EG5_C 3B5I_B.
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1m6e_X 359 Crystal Structure Of Salicylic Acid Carboxyl Methyl 5e-13
2efj_A 384 The Structure Of 1,7 Dimethylxanthine Methyltransfe 2e-09
2eg5_A 372 The Structure Of Xanthosine Methyltransferase Lengt 1e-08
3b5i_A 374 Crystal Structure Of Indole-3-Acetic Acid Methyltra 1e-07
>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359 Back     alignment and structure 
Iteration: 1

 Score = 69.7 bits (169), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (2%)
Query: 54  EFPFYLNDLLGNDFNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYG 113
           E+  +LNDL GNDFN +F+ L    E   D   F  G PGSF+G LFP N+LH +HSSY 
Sbjct: 91  EYQIFLNDLPGNDFNAIFRSLP--IENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYS 148
Query: 114 AHWLSKMRLPI 124
             WLS++ + I
Sbjct: 149 LMWLSQVPIGI 159
>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384 Back     alignment and structure
>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372 Back     alignment and structure
>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 1e-19
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 3e-17
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 8e-17
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374 Back     alignment and structure
 Score = 82.1 bits (202), Expect = 1e-19
 Identities = 35/139 (25%), Positives = 55/139 (39%), Gaps = 22/139 (15%)

Query: 18  DLLGEEGISNEILNVTYFGCSSNPSTFSVVSSVIE-------------NEFPFYLNDLLG 64
           ++      S         GCSS  +T  ++  +++              EF  + +DL  
Sbjct: 42  NVHLNSSASPPPFTAVDLGCSSGANTVHIIDFIVKHISKRFDAAGIDPPEFTAFFSDLPS 101

Query: 65  NDFNMLFQGLSSFAER---------YKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAH 115
           NDFN LFQ L                 + S F  G PGSF+  LFP  ++   HS++  H
Sbjct: 102 NDFNTLFQLLPPLVSNTCMEECLAADGNRSYFVAGVPGSFYRRLFPARTIDFFHSAFSLH 161

Query: 116 WLSKMRLPILKYMLICYSC 134
           WLS++   +       Y+ 
Sbjct: 162 WLSQVPESVTDRRSAAYNR 180
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 100.0
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 100.0
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 100.0
3dtn_A234 Putative methyltransferase MM_2633; structural gen 96.64
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 96.55
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 96.28
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 96.21
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 96.16
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 96.08
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 96.01
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 95.96
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 95.92
3dh0_A219 SAM dependent methyltransferase; cystal structure, 95.85
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 95.85
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 95.71
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 95.71
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 95.65
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 95.63
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 95.59
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 95.58
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 95.57
3hnr_A220 Probable methyltransferase BT9727_4108; structural 95.54
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 95.53
3m70_A286 Tellurite resistance protein TEHB homolog; structu 95.52
3ege_A 261 Putative methyltransferase from antibiotic biosyn 95.49
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 95.39
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 95.35
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 95.32
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 95.26
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 95.24
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 95.2
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 95.19
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 95.12
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 95.11
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 95.02
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 95.02
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 94.97
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 94.89
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 94.88
3lcc_A235 Putative methyl chloride transferase; halide methy 94.84
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 94.84
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 94.82
1xxl_A 239 YCGJ protein; structural genomics, protein structu 94.81
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 94.8
3f4k_A 257 Putative methyltransferase; structural genomics, P 94.79
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 94.73
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 94.62
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 94.6
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 94.52
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 94.44
2r3s_A335 Uncharacterized protein; methyltransferase domain, 94.38
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 94.37
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 94.33
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 94.29
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 94.29
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 94.28
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 94.28
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 94.24
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 94.1
3cc8_A 230 Putative methyltransferase; structural genomics, j 94.08
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 94.02
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 93.98
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 93.94
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 93.91
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 93.85
2p7i_A 250 Hypothetical protein; putative methyltransferase, 93.85
3i9f_A170 Putative type 11 methyltransferase; structural gen 93.73
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 93.71
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 93.61
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 93.54
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 93.52
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 93.33
3dp7_A363 SAM-dependent methyltransferase; structural genomi 93.32
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 93.02
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 92.82
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 92.76
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 92.75
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 92.68
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 92.54
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 92.53
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 92.51
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 92.49
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 92.46
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 92.38
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 92.37
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 92.34
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 92.29
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 92.28
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 92.15
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 91.75
1vlm_A219 SAM-dependent methyltransferase; possible histamin 91.65
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 91.54
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 91.49
2kw5_A202 SLR1183 protein; structural genomics, northeast st 91.34
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 91.27
3ocj_A305 Putative exported protein; structural genomics, PS 91.15
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 91.13
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 91.1
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 91.04
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 90.93
1jsx_A207 Glucose-inhibited division protein B; methyltransf 90.22
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 90.0
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 89.88
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 89.74
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 89.4
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 89.36
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 89.18
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 89.16
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 88.75
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 88.55
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 88.49
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 88.47
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 87.74
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 87.47
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 87.45
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 87.21
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 87.19
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 86.73
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 86.25
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 86.09
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 85.99
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 85.89
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 85.0
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 84.45
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 84.23
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 84.22
2esr_A177 Methyltransferase; structural genomics, hypothetic 83.92
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 83.55
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 83.42
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 83.14
1ws6_A171 Methyltransferase; structural genomics, riken stru 82.83
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 82.74
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 82.04
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 82.04
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 81.18
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 81.0
3duw_A223 OMT, O-methyltransferase, putative; alternating of 80.99
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 80.72
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 80.38
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 80.33
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 80.09
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
Probab=100.00  E-value=2.8e-43  Score=298.07  Aligned_cols=123  Identities=36%  Similarity=0.574  Sum_probs=109.6

Q ss_pred             HhhhhhhhccccccccC------C-CCcceEEEeecCCCCcccHHHHHHhhc--------------CceeEEecCCCCCc
Q 045170            8 SQYWRVQFNLDLLGEEG------I-SNEILNVTYFGCSSNPSTFSVVSSVIE--------------NEFPFYLNDLLGND   66 (135)
Q Consensus         8 ~q~~~~~~~l~ll~~~~------~-~~~~~~IaDlGCS~G~NSl~~i~~iI~--------------peiqv~~nDLP~ND   66 (135)
                      .|+.++...+|++.++.      . .+++++|||||||+|+||+.++++||+              |||||+|||||+||
T Consensus        24 ~Q~~~~~~~~~~l~~ai~~~~~~~~~~~~~~IaDlGCs~G~Nt~~~v~~ii~~i~~~~~~~~~~~~pe~~v~~nDLp~ND  103 (359)
T 1m6e_X           24 IQRQVISITKPITEAAITALYSGDTVTTRLAIADLGCSSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGND  103 (359)
T ss_dssp             HHHHHHHHTHHHHHHHHHHHHSSSSSSSEECCEEESCCSSTTTTTGGGTTHHHHHHHHHSSSCSSCCEEEEEEEECTTSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccCCCCceEEEecCCCCCcchHHHHHHHHHHHHHHHHhcCCCCCCceEEEecCCCchH
Confidence            38888888899987643      2 678999999999999999999999876              58999999999999


Q ss_pred             hHHHhhcchhhhhhccCCCEEEEecCCcccccccCCCceeeEecchhhhccccCCccccccceece
Q 045170           67 FNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYMLICY  132 (135)
Q Consensus        67 FntLF~~l~~~~~~~~~~~~f~~~vpgSFY~rLfP~~Svh~~~Ss~alHWLS~~P~~l~d~~~~~~  132 (135)
                      ||+||++|+.+..  .+++||++|||||||+||||++|+|++||++||||||++|+++.+|.+.+|
T Consensus       104 FntlF~~L~~~~~--~~~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~aLHWls~~p~~l~~nkg~i~  167 (359)
T 1m6e_X          104 FNAIFRSLPIEND--VDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIESNKGNIY  167 (359)
T ss_dssp             HHHHHTTTTTSCS--CTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCCSCCCCCTTTTS
T ss_pred             HHHHHHhcchhcc--cCCCEEEEecchhhhhccCCCCceEEEEehhhhhhcccCchhhhccCCceE
Confidence            9999999998751  126799999999999999999999999999999999999999998777666
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1m6ex_ 359 c.66.1.35 (X:) Salicylic acid carboxyl methyltrans 4e-24
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

 Score = 93.1 bits (231), Expect = 4e-24
 Identities = 40/108 (37%), Positives = 55/108 (50%), Gaps = 16/108 (14%)

Query: 27  NEILNVTYFGCSSNPSTFSVVSSVIEN--------------EFPFYLNDLLGNDFNMLFQ 72
              L +   GCSS P+    V+ +I+               E+  +LNDL GNDFN +F+
Sbjct: 50  TTRLAIADLGCSSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFR 109

Query: 73  GLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKM 120
            L    +       F  G PGSF+G LFP N+LH +HSSY   WLS++
Sbjct: 110 SLPIENDVDG--VCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQV 155

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 97.16
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.11
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.65
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 96.64
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 96.58
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 96.15
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.11
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 96.08
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 95.99
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 95.93
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 95.69
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 95.46
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 95.38
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 95.29
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 95.27
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 94.84
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 94.83
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 94.82
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 94.63
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 94.61
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 94.43
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 94.09
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 93.74
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 93.7
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 93.15
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 93.06
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 92.26
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 92.07
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 90.53
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 90.51
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 88.13
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 87.8
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 84.55
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 84.36
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 84.34
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 83.81
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 83.8
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 83.11
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 82.59
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 82.2
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 80.68
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

Probab=100.00  E-value=5.5e-48  Score=325.69  Aligned_cols=125  Identities=35%  Similarity=0.571  Sum_probs=112.4

Q ss_pred             HhhhhhhhccccccccC-------CCCcceEEEeecCCCCcccHHHHHHhhc--------------CceeEEecCCCCCc
Q 045170            8 SQYWRVQFNLDLLGEEG-------ISNEILNVTYFGCSSNPSTFSVVSSVIE--------------NEFPFYLNDLLGND   66 (135)
Q Consensus         8 ~q~~~~~~~l~ll~~~~-------~~~~~~~IaDlGCS~G~NSl~~i~~iI~--------------peiqv~~nDLP~ND   66 (135)
                      -|+.+...+.|++.++.       ..+++++|||||||+|+||+.+|++||+              |||||||||||+||
T Consensus        24 ~Q~~~i~~~kp~leeai~~~~~~~~~~~~~~IADlGCS~G~Ntl~~v~~iI~~i~~~~~~~~~~~~pe~qvf~nDLP~ND  103 (359)
T d1m6ex_          24 IQRQVISITKPITEAAITALYSGDTVTTRLAIADLGCSSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGND  103 (359)
T ss_dssp             HHHHHHHHTHHHHHHHHHHHHSSSSSSSEECCEEESCCSSTTTTTGGGTTHHHHHHHHHSSSCSSCCEEEEEEEECTTSC
T ss_pred             HHHHHHHHHHHHHHHHHHhcccCCCCCCceEEEEeCCCCCccHHHHHHHHHHHHHHHHHhcCCCCCCeEEEEeCCCCcch
Confidence            57888899999998753       3578899999999999999999999987              68999999999999


Q ss_pred             hHHHhhcchhhhhhccCCCEEEEecCCcccccccCCCceeeEecchhhhccccCCccccccceeceec
Q 045170           67 FNMLFQGLSSFAERYKDLSLFTVGAPGSFHGWLFPTNSLHLVHSSYGAHWLSKMRLPILKYMLICYSC  134 (135)
Q Consensus        67 FntLF~~l~~~~~~~~~~~~f~~~vpgSFY~rLfP~~Svh~~~Ss~alHWLS~~P~~l~d~~~~~~~~  134 (135)
                      ||+||++|+...+  ..++||++|||||||+||||++||||+||++|||||||+|+++.++.+++|-+
T Consensus       104 FNtLF~~L~~~~~--~~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHWLS~vP~~l~~n~~~i~~~  169 (359)
T d1m6ex_         104 FNAIFRSLPIEND--VDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIESNKGNIYMA  169 (359)
T ss_dssp             HHHHHTTTTTSCS--CTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCCSCCCCCTTTTSSC
T ss_pred             HHHHHHhcccccc--CCCCeEEEecCCchhhhcCCCCceEEeeehhhhhhhhcCCccccCCCCcEEEc
Confidence            9999999986432  23789999999999999999999999999999999999999999988888753
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure