Citrus Sinensis ID: 045292

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670---

MFQPNTFESHHMFDMTRRSSESDLGKLKEDDYETKSGTETMEMEAPSGDDQDPSQHPKRKRYHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKAQHERHENQILKAENQKLRAENNRYKEALGNATCPNCGGPAALGEMSFDEQHLRIENARLREEIDRISGIAAKYVGKPLSSFPHLTPRSLDLGFTNLGTQSGFVGEMYGGCDLIRSISGPSEADKPMIVELAVAAMEEFLRMAQAGDPLWTDQNQWSSVFCGIVSRAMTIEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRENYFVRYCKQHSDGTWAVVDVSLDNLRPSPTSKCRRRPSGCLIQELPNGYSKVIWVEHVEVDDRSVHNIYKPLVNSGLAFGAKRWVATLDRQCERLASSMANNIPAGDLCVITSPEGRKSMLKLAERMVTSFCTGVGASTAHAWTTLSATGSDDVRVMTRKSMDDPGRPPGIVLSAATSFWIPVPPRRIFDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGNCVSLLRVNSANSSQSNMLVLQESCTDSTGSYVIYAPVDIVAMNMVLSGGDPDYVALLPSGFAILPDGPGFNGGGILEVGSGGSLLTVAFQILVDSVPTAKLSLGSVATVNSLIKCTVERIKAAVMTDNASCR

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHcccccHHccEEEEEEEcccccccccEEEEEEEHHccccccccccEEEEEEEEEEccccCEEEEEEEcccccccccccCEEcccccEEEEcccccEEEEEEEEEECcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEccccccccccCEEEEEEccccccccHHHHHHHHcccccccccHHccccccEEEEEEcccccccccEEEEEEEcccccccccEEEEEHccccccccEEEEccccHHHHHHHHcccccccccccccccEEccccccccccccccccccccEEEEEHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccc

*******************************************************************RQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK*******************************ATCPNCGGPAALGEMSFDEQHLRIENARLREEIDRISGIAAKYVGKPLSSFPHLTPRSLDLGFTNLGTQSGFVGEMYGGCDLIRSISG***ADKPMIVELAVAAMEEFLRMAQAGDPLWTDQNQWSSVFCGIVSRAMTIEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRENYFVRYCKQHSDGTWAVVDVSLDNLRPSPTSKCRRRPSGCLIQELPNGYSKVIWVEHVEVDDRSVHNIYKPLVNSGLAFGAKRWVATLDRQCERLASSMANNIPAGDLCVITSPEGRKSMLKLAERMVTSFCTGVGASTAHAWTTLSATGSDDVRVMTRKSM***GRPPGIVLSAATSFWIPVPPRRIFDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGNCVSLLRVNSANSSQSNMLVLQESCTDSTGSYVIYAPVDIVAMNMVLSGGDPDYVALLPSGFAILPDGP************GGSLLTVAFQILVDSVPTAKLSLGSVATVNSLIKCTVERIKAAVMT******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFQPNTFESHHMFDMTRRSSESDLGKLKEDDYETKSGTETMEMEAPSGDDQDPSQHPKRKRYHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxATCPNCGGPAALGEMSFDEQHLRIENARLREEIDRISGIAAKYVGKPLSSFPHLTPRSLDLGFTNLGTQSGFVGEMYGGCDLIRSISGPSEADKPMIVELAVAAMEEFLRMAQAGDPLWTDQNQWSSVFCGIVSRAMTIEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRENYFVRYCKQHSDGTWAVVDVSLDNLRPSPTSKCRRRPSGCLIQELPNGYSKVIWVEHVEVDDRSVHNIYKPLVNSGLAFGAKRWVATLDRQCERLASSMANNIPAGDLCVITSPEGRKSMLKLAERMVTSFCTGVGASTAHAWTTLSATGSDDVRVMTRKSMDDPGRPPGIVLSAATSFWIPVPPRRIFDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGNCVSLLRVNSANSSQSNMLVLQESCTDSTGSYVIYAPVDIVAMNMVLSGGDPDYVALLPSGFAILPDGPGFNGGGILEVGSGGSLLTVAFQILVDSVPTAKLSLGSVATVNSLIKCTVERIKAAVMTDNASCR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Homeobox-leucine zipper protein PROTODERMAL FACTOR 2	Probable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1.	confident	Q93V99
Homeobox-leucine zipper protein ROC1	Probable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis.	confident	Q6ZAR0
Homeobox-leucine zipper protein ROC7	Probable transcription factor.	probable	A2YR02

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A01, chain A
Confidence level:very confident
Coverage over the Query: 54-113
View the alignment between query and template
View the model in PyMOL

Template: 2R55, chain A
Confidence level:confident
Coverage over the Query: 238-412
View the alignment between query and template
View the model in PyMOL

Template: 2R55, chain A
Confidence level:confident
Coverage over the Query: 433-608,621-666
View the alignment between query and template
View the model in PyMOL

Template: 3FO5, chain A
Confidence level:confident
Coverage over the Query: 398-608
View the alignment between query and template
View the model in PyMOL

Template: 1CI6, chain A
Confidence level:probable
Coverage over the Query: 119-143,165-179
View the alignment between query and template
View the model in PyMOL