Citrus Sinensis ID: 045292
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 673 | 2.2.26 [Sep-21-2011] | |||||||
| Q93V99 | 743 | Homeobox-leucine zipper p | yes | no | 0.989 | 0.896 | 0.767 | 0.0 | |
| Q8RWU4 | 762 | Homeobox-leucine zipper p | no | no | 0.994 | 0.877 | 0.744 | 0.0 | |
| Q6ZAR0 | 784 | Homeobox-leucine zipper p | yes | no | 0.956 | 0.821 | 0.715 | 0.0 | |
| Q94C37 | 721 | Homeobox-leucine zipper p | no | no | 0.974 | 0.909 | 0.672 | 0.0 | |
| Q0J9X2 | 784 | Homeobox-leucine zipper p | no | no | 0.947 | 0.813 | 0.709 | 0.0 | |
| A2YR02 | 749 | Homeobox-leucine zipper p | N/A | no | 0.933 | 0.838 | 0.659 | 0.0 | |
| A3BPF2 | 749 | Homeobox-leucine zipper p | no | no | 0.933 | 0.838 | 0.656 | 0.0 | |
| Q0WV12 | 802 | Homeobox-leucine zipper p | no | no | 0.940 | 0.789 | 0.502 | 0.0 | |
| Q9M2E8 | 808 | Homeobox-leucine zipper p | no | no | 0.947 | 0.789 | 0.471 | 0.0 | |
| Q9ZV65 | 725 | Homeobox-leucine zipper p | no | no | 0.887 | 0.823 | 0.485 | 1e-180 |
| >sp|Q93V99|PDF2_ARATH Homeobox-leucine zipper protein PROTODERMAL FACTOR 2 OS=Arabidopsis thaliana GN=PDF2 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 1122 bits (2901), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 568/740 (76%), Positives = 610/740 (82%), Gaps = 74/740 (10%)
Query: 1 MFQPNTFESHHMFDMTRRS-SESDLGKL--KEDDYETKSGTETMEMEAPSGDD-QDPSQH 56
M+ PN FESHHMFDMT +S S++DLG +EDD+ETKSGTE + E PSG++ QDPSQ
Sbjct: 1 MYHPNMFESHHMFDMTPKSTSDNDLGITGSREDDFETKSGTE-VTTENPSGEELQDPSQR 59
Query: 57 P-KRKRYHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKA 115
P K+KRYHRHTQRQIQE+E+FFKECPHPDDKQRKELSR+L LEPLQVKFWFQNKRTQMKA
Sbjct: 60 PNKKKRYHRHTQRQIQELESFFKECPHPDDKQRKELSRDLNLEPLQVKFWFQNKRTQMKA 119
Query: 116 QHERHENQILKAENQKLRAENNRYKEALGNATCPNCGGPAALGEMSFDEQHLRIENARLR 175
Q ERHENQILK++N KLRAENNRYKEAL NATCPNCGGPAA+GEMSFDEQHLRIENARLR
Sbjct: 120 QSERHENQILKSDNDKLRAENNRYKEALSNATCPNCGGPAAIGEMSFDEQHLRIENARLR 179
Query: 176 EEIDRISGIAAKYVGKPL-SSFP----HLTPRSLDLGFTNLGTQSGFVGEMYGGCDLIRS 230
EEIDRIS IAAKYVGKPL SSF H RSLDL N G Q+GFVGEMYG D++RS
Sbjct: 180 EEIDRISAIAAKYVGKPLGSSFAPLAIHAPSRSLDLEVGNFGNQTGFVGEMYGTGDILRS 239
Query: 231 ISGPSEADKPMIVELAVAAMEEFLRMAQAGDPLW-------------------------- 264
+S PSE DKP+IVELAVAAMEE +RMAQ GDPLW
Sbjct: 240 VSIPSETDKPIIVELAVAAMEELVRMAQTGDPLWLSTDNSVEILNEEEYFRTFPRGIGPK 299
Query: 265 --------------------------TDQNQWSSVFCGIVSRAMTIEVLSTGVAGNYNGA 298
D NQWS VF GIVSRA+T+EVLSTGVAGNYNGA
Sbjct: 300 PLGLRSEASRQSAVVIMNHINLVEILMDVNQWSCVFSGIVSRALTLEVLSTGVAGNYNGA 359
Query: 299 LQVMTAEFQVPSPLVPTRENYFVRYCKQHSDGTWAVVDVSLDNLRPS-PTSKCRRRPSGC 357
LQVMTAEFQVPSPLVPTRENYFVRYCKQHSDG+WAVVDVSLD+LRPS P + RRRPSGC
Sbjct: 360 LQVMTAEFQVPSPLVPTRENYFVRYCKQHSDGSWAVVDVSLDSLRPSTPILRTRRRPSGC 419
Query: 358 LIQELPNGYSKVIWVEHVEVDDRSVHNIYKPLVNSGLAFGAKRWVATLDRQCERLASSMA 417
LIQELPNGYSKV W+EH+EVDDRSVHN+YKPLV SGLAFGAKRWVATL+RQCERLASSMA
Sbjct: 420 LIQELPNGYSKVTWIEHMEVDDRSVHNMYKPLVQSGLAFGAKRWVATLERQCERLASSMA 479
Query: 418 NNIPAGDLCVITSPEGRKSMLKLAERMVTSFCTGVGASTAHAWTTLSATGSDDVRVMTRK 477
+NIP GDL VITSPEGRKSMLKLAERMV SFC+GVGASTAHAWTT+S TGSDDVRVMTRK
Sbjct: 480 SNIP-GDLSVITSPEGRKSMLKLAERMVMSFCSGVGASTAHAWTTMSTTGSDDVRVMTRK 538
Query: 478 SMDDPGRPPGIVLSAATSFWIPVPPRRIFDFLRDENSRSEWDILSNGGLVQEMAHIANGR 537
SMDDPGRPPGIVLSAATSFWIPV P+R+FDFLRDENSR EWDILSNGG+VQEMAHIANG
Sbjct: 539 SMDDPGRPPGIVLSAATSFWIPVAPKRVFDFLRDENSRKEWDILSNGGMVQEMAHIANGH 598
Query: 538 DPGNCVSLLRVNSANSSQSNMLVLQESCTDSTGSYVIYAPVDIVAMNMVLSGGDPDYVAL 597
+PGNCVSLLRVNS NSSQSNML+LQESCTD++GSYVIYAPVDIVAMN+VLSGGDPDYVAL
Sbjct: 599 EPGNCVSLLRVNSGNSSQSNMLILQESCTDASGSYVIYAPVDIVAMNVVLSGGDPDYVAL 658
Query: 598 LPSGFAILPDGPGFNGGG--------ILEVGS-GGSLLTVAFQILVDSVPTAKLSLGSVA 648
LPSGFAILPDG G G GS GGSLLTVAFQILVDSVPTAKLSLGSVA
Sbjct: 659 LPSGFAILPDGSVGGGDGNQHQEMVSTTSSGSCGGSLLTVAFQILVDSVPTAKLSLGSVA 718
Query: 649 TVNSLIKCTVERIKAAVMTD 668
TVNSLIKCTVERIKAAV D
Sbjct: 719 TVNSLIKCTVERIKAAVSCD 738
|
Probable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q8RWU4|ATML1_ARATH Homeobox-leucine zipper protein MERISTEM L1 OS=Arabidopsis thaliana GN=ATML1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZAR0|ROC1_ORYSJ Homeobox-leucine zipper protein ROC1 OS=Oryza sativa subsp. japonica GN=ROC1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q94C37|HDG2_ARATH Homeobox-leucine zipper protein HDG2 OS=Arabidopsis thaliana GN=HDG2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0J9X2|ROC2_ORYSJ Homeobox-leucine zipper protein ROC2 OS=Oryza sativa subsp. japonica GN=ROC2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A2YR02|ROC7_ORYSI Homeobox-leucine zipper protein ROC7 OS=Oryza sativa subsp. indica GN=ROC7 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A3BPF2|ROC7_ORYSJ Homeobox-leucine zipper protein ROC7 OS=Oryza sativa subsp. japonica GN=ROC7 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0WV12|ANL2_ARATH Homeobox-leucine zipper protein ANTHOCYANINLESS 2 OS=Arabidopsis thaliana GN=ANL2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9M2E8|HDG1_ARATH Homeobox-leucine zipper protein HDG1 OS=Arabidopsis thaliana GN=HDG1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9ZV65|HDG3_ARATH Homeobox-leucine zipper protein HDG3 OS=Arabidopsis thaliana GN=HDG3 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 673 | ||||||
| 397134751 | 725 | HD-1A [Gossypium hirsutum] | 0.992 | 0.921 | 0.828 | 0.0 | |
| 397134753 | 725 | HD-1D [Gossypium hirsutum] | 0.992 | 0.921 | 0.825 | 0.0 | |
| 224078678 | 725 | predicted protein [Populus trichocarpa] | 0.992 | 0.921 | 0.814 | 0.0 | |
| 224116084 | 720 | predicted protein [Populus trichocarpa] | 0.982 | 0.918 | 0.802 | 0.0 | |
| 255554965 | 727 | homeobox protein, putative [Ricinus comm | 0.992 | 0.918 | 0.794 | 0.0 | |
| 225444363 | 726 | PREDICTED: homeobox-leucine zipper prote | 0.991 | 0.918 | 0.789 | 0.0 | |
| 312282177 | 749 | unnamed protein product [Thellungiella h | 0.991 | 0.890 | 0.768 | 0.0 | |
| 18412734 | 743 | homeobox-leucine zipper protein PROTODER | 0.989 | 0.896 | 0.767 | 0.0 | |
| 356540579 | 732 | PREDICTED: homeobox-leucine zipper prote | 0.991 | 0.911 | 0.764 | 0.0 | |
| 147800352 | 708 | hypothetical protein VITISV_039239 [Viti | 0.965 | 0.918 | 0.773 | 0.0 |
| >gi|397134751|gb|AFO11041.1| HD-1A [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Score = 1231 bits (3185), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 602/727 (82%), Positives = 637/727 (87%), Gaps = 59/727 (8%)
Query: 1 MFQPNTFESHHMFDMTRRSSESDL-GKLKEDDYETKSGTETMEMEAPSGDDQDPSQHPKR 59
MF PN FES HMFDM+ ++SES+L GK+++DDYE KS TETM+ APSGDDQDP Q PK
Sbjct: 1 MFSPNLFESPHMFDMSHKTSESELMGKVRDDDYEIKSVTETMD--APSGDDQDPDQRPKM 58
Query: 60 KRYHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKAQHER 119
K YHRHTQRQIQEMEAFFKECPHPDDKQRKEL RELGLEPLQVKFWFQNKRTQMKAQHER
Sbjct: 59 KCYHRHTQRQIQEMEAFFKECPHPDDKQRKELGRELGLEPLQVKFWFQNKRTQMKAQHER 118
Query: 120 HENQILKAENQKLRAENNRYKEALGNATCPNCGGPAALGEMSFDEQHLRIENARLREEID 179
HEN ILKAEN+KLRAENNRYKEAL NATCP+CGGPAALGEMSFDEQ LRIENARLREEID
Sbjct: 119 HENAILKAENEKLRAENNRYKEALSNATCPSCGGPAALGEMSFDEQLLRIENARLREEID 178
Query: 180 RISGIAAKYVGKPLSSFPHLTP----RSLDLGFTNLGTQSGFVGEMYGGCDLIRSISGPS 235
RISGIAAKYVGKPLSS PHL+ RS+DLG +N GTQSGFVGEM DL+RS+SGP+
Sbjct: 179 RISGIAAKYVGKPLSSLPHLSSHLHSRSVDLGASNFGTQSGFVGEMDRSGDLLRSVSGPT 238
Query: 236 EADKPMIVELAVAAMEEFLRMAQAGDPLWT------------------------------ 265
EADKPMIVELAVAAMEE +RMAQ+G+PLW
Sbjct: 239 EADKPMIVELAVAAMEELIRMAQSGEPLWVPGDNSIDVLSEDEYLRTFPRGIGPKPLGLR 298
Query: 266 ----------------------DQNQWSSVFCGIVSRAMTIEVLSTGVAGNYNGALQVMT 303
D NQWSSVFCGIVSRAMT+EVLSTGVAGNYNGALQVMT
Sbjct: 299 SEASRESAVVIMNHVNLVEILMDVNQWSSVFCGIVSRAMTLEVLSTGVAGNYNGALQVMT 358
Query: 304 AEFQVPSPLVPTRENYFVRYCKQHSDGTWAVVDVSLDNLRPSPTSKCRRRPSGCLIQELP 363
AEFQVPSPLVPTRENYFVRYCKQH DGTWAVVDVSLDNLRP+P SKCRRRPSGCLIQELP
Sbjct: 359 AEFQVPSPLVPTRENYFVRYCKQHIDGTWAVVDVSLDNLRPNPMSKCRRRPSGCLIQELP 418
Query: 364 NGYSKVIWVEHVEVDDRSVHNIYKPLVNSGLAFGAKRWVATLDRQCERLASSMANNIPAG 423
NGYSKVIWVEHVEVDDR++HNIY+P+VNSGLAFGAKRWVATLDRQCERLASSMA+NIPAG
Sbjct: 419 NGYSKVIWVEHVEVDDRAIHNIYRPVVNSGLAFGAKRWVATLDRQCERLASSMASNIPAG 478
Query: 424 DLCVITSPEGRKSMLKLAERMVTSFCTGVGASTAHAWTTLSATGSDDVRVMTRKSMDDPG 483
DLCVITS EGRKSMLKLAERMVTSFCTGVGASTAHAWT+LSATGSDDVRVMTRKSMDDPG
Sbjct: 479 DLCVITSLEGRKSMLKLAERMVTSFCTGVGASTAHAWTSLSATGSDDVRVMTRKSMDDPG 538
Query: 484 RPPGIVLSAATSFWIPVPPRRIFDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGNCV 543
RPPGIVLSAATSFWIPVPP+R+FDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGNCV
Sbjct: 539 RPPGIVLSAATSFWIPVPPKRVFDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGNCV 598
Query: 544 SLLRVNSANSSQSNMLVLQESCTDSTGSYVIYAPVDIVAMNMVLSGGDPDYVALLPSGFA 603
SLLRVNSANSSQSNML+LQESCTD+TGSYVIYAPVDIVAMN+VLSGGDPDY+ALLPSGFA
Sbjct: 599 SLLRVNSANSSQSNMLILQESCTDATGSYVIYAPVDIVAMNVVLSGGDPDYLALLPSGFA 658
Query: 604 ILPDGPGFNGGGILEVGSGGSLLTVAFQILVDSVPTAKLSLGSVATVNSLIKCTVERIKA 663
ILPDGPG NGGGILE+GSGGSLLTVAFQILVDSVPTAKLSLGSV TVNSLIKCTVERIKA
Sbjct: 659 ILPDGPGVNGGGILEIGSGGSLLTVAFQILVDSVPTAKLSLGSVTTVNSLIKCTVERIKA 718
Query: 664 AVMTDNA 670
AVM +NA
Sbjct: 719 AVMCNNA 725
|
Source: Gossypium hirsutum Species: Gossypium hirsutum Genus: Gossypium Family: Malvaceae Order: Malvales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|397134753|gb|AFO11042.1| HD-1D [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|224078678|ref|XP_002305602.1| predicted protein [Populus trichocarpa] gi|222848566|gb|EEE86113.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224116084|ref|XP_002317205.1| predicted protein [Populus trichocarpa] gi|222860270|gb|EEE97817.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255554965|ref|XP_002518520.1| homeobox protein, putative [Ricinus communis] gi|223542365|gb|EEF43907.1| homeobox protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225444363|ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Vitis vinifera] gi|302144076|emb|CBI23181.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|312282177|dbj|BAJ33954.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|18412734|ref|NP_567274.1| homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Arabidopsis thaliana] gi|75331628|sp|Q93V99.1|PDF2_ARATH RecName: Full=Homeobox-leucine zipper protein PROTODERMAL FACTOR 2; AltName: Full=HD-ZIP protein PDF2; AltName: Full=Homeodomain transcription factor PDF2 gi|15983372|gb|AAL11554.1|AF424560_1 AT4g04890/T1J1_3 [Arabidopsis thaliana] gi|14276060|dbj|BAB58961.1| protodermal factor2 [Arabidopsis thaliana] gi|17064998|gb|AAL32653.1| Unknown protein [Arabidopsis thaliana] gi|23197872|gb|AAN15463.1| Unknown protein [Arabidopsis thaliana] gi|332657038|gb|AEE82438.1| homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356540579|ref|XP_003538765.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147800352|emb|CAN62139.1| hypothetical protein VITISV_039239 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 673 | ||||||
| TAIR|locus:2119048 | 762 | ATML1 "AT4G21750" [Arabidopsis | 0.509 | 0.450 | 0.912 | 2.7e-297 | |
| TAIR|locus:2135368 | 743 | PDF2 "AT4G04890" [Arabidopsis | 0.597 | 0.541 | 0.842 | 1.4e-293 | |
| TAIR|locus:2207235 | 721 | HDG2 "AT1G05230" [Arabidopsis | 0.597 | 0.557 | 0.792 | 7.8e-260 | |
| TAIR|locus:2127008 | 802 | ANL2 "ANTHOCYANINLESS 2" [Arab | 0.595 | 0.5 | 0.560 | 7.9e-181 | |
| TAIR|locus:2098866 | 808 | HDG1 "AT3G61150" [Arabidopsis | 0.598 | 0.498 | 0.537 | 2.6e-171 | |
| TAIR|locus:2062540 | 725 | HDG3 "AT2G32370" [Arabidopsis | 0.573 | 0.532 | 0.517 | 1.3e-165 | |
| TAIR|locus:2206880 | 722 | HDG11 "AT1G73360" [Arabidopsis | 0.600 | 0.559 | 0.465 | 6.5e-151 | |
| TAIR|locus:2030913 | 687 | HDG12 "homeodomain GLABROUS 12 | 0.569 | 0.557 | 0.477 | 2.9e-148 | |
| TAIR|locus:2145116 | 682 | HDG7 "AT5G52170" [Arabidopsis | 0.952 | 0.939 | 0.448 | 7.5e-144 | |
| TAIR|locus:2129396 | 709 | HDG4 "AT4G17710" [Arabidopsis | 0.575 | 0.545 | 0.432 | 1.3e-119 |
| TAIR|locus:2119048 ATML1 "AT4G21750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1659 (589.1 bits), Expect = 2.7e-297, Sum P(3) = 2.7e-297
Identities = 313/343 (91%), Positives = 329/343 (95%)
Query: 266 DQNQWSSVFCGIVSRAMTIEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRENYFVRYCK 325
D NQWSSVFCGIVSRA+T+EVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRENYFVRYCK
Sbjct: 336 DVNQWSSVFCGIVSRALTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRENYFVRYCK 395
Query: 326 QHSDGTWAVVDVSLDNLRPSPTSKCRRRPSGCLIQELPNGYSKVIWVEHVEVDDRSVHNI 385
QHSDG WAVVDVSLD+LRPSP ++ RRRPSGCLIQEL NGYSKV WVEH+EVDDRSVHN+
Sbjct: 396 QHSDGIWAVVDVSLDSLRPSPITRSRRRPSGCLIQELQNGYSKVTWVEHIEVDDRSVHNM 455
Query: 386 YKPLVNSGLAFGAKRWVATLDRQCERLASSMANNIPAGDLCVITSPEGRKSMLKLAERMV 445
YKPLVN+GLAFGAKRWVATLDRQCERLASSMA+NIPA DL VITSPEGRKSMLKLAERMV
Sbjct: 456 YKPLVNTGLAFGAKRWVATLDRQCERLASSMASNIPACDLSVITSPEGRKSMLKLAERMV 515
Query: 446 TSFCTGVGASTAHAWTTLSATGSDDVRVMTRKSMDDPGRPPGIVLSAATSFWIPVPPRRI 505
SFCTGVGASTAHAWTTLS TGSDDVRVMTRKSMDDPGRPPGIVLSAATSFWIPV P+R+
Sbjct: 516 MSFCTGVGASTAHAWTTLSTTGSDDVRVMTRKSMDDPGRPPGIVLSAATSFWIPVAPKRV 575
Query: 506 FDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGNCVSLLRVNSANSSQSNMLVLQESC 565
FDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGN VSLLRVNS NS QSNML+LQESC
Sbjct: 576 FDFLRDENSRSEWDILSNGGLVQEMAHIANGRDPGNSVSLLRVNSGNSGQSNMLILQESC 635
Query: 566 TDSTGSYVIYAPVDIVAMNMVLSGGDPDYVALLPSGFAILPDG 608
TD++GSYVIYAPVDI+AMN+VLSGGDPDYVALLPSGFAILPDG
Sbjct: 636 TDASGSYVIYAPVDIIAMNVVLSGGDPDYVALLPSGFAILPDG 678
|
|
| TAIR|locus:2135368 PDF2 "AT4G04890" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2207235 HDG2 "AT1G05230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127008 ANL2 "ANTHOCYANINLESS 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098866 HDG1 "AT3G61150" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062540 HDG3 "AT2G32370" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2206880 HDG11 "AT1G73360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2030913 HDG12 "homeodomain GLABROUS 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2145116 HDG7 "AT5G52170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129396 HDG4 "AT4G17710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q6ZAR0 | ROC1_ORYSJ | No assigned EC number | 0.7154 | 0.9569 | 0.8214 | yes | no |
| Q8RWU4 | ATML1_ARATH | No assigned EC number | 0.7444 | 0.9940 | 0.8779 | no | no |
| Q0J9X2 | ROC2_ORYSJ | No assigned EC number | 0.7097 | 0.9479 | 0.8137 | no | no |
| A2YR02 | ROC7_ORYSI | No assigned EC number | 0.6592 | 0.9331 | 0.8384 | N/A | no |
| Q93V99 | PDF2_ARATH | No assigned EC number | 0.7675 | 0.9895 | 0.8963 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | fgenesh4_pg.C_LG_IV000079 | hypothetical protein (725 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 673 | |||
| cd08875 | 229 | cd08875, START_ArGLABRA2_like, C-terminal lipid-bi | 9e-87 | |
| pfam01852 | 205 | pfam01852, START, START domain | 1e-48 | |
| smart00234 | 205 | smart00234, START, in StAR and phosphatidylcholine | 6e-38 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 4e-21 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 3e-19 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 4e-18 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 5e-11 | |
| cd00177 | 193 | cd00177, START, Lipid-binding START domain of mamm | 5e-07 | |
| TIGR02894 | 161 | TIGR02894, DNA_bind_RsfA, transcription factor, Rs | 5e-05 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 0.001 |
| >gnl|CDD|176884 cd08875, START_ArGLABRA2_like, C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
Score = 271 bits (694), Expect = 9e-87
Identities = 100/149 (67%), Positives = 120/149 (80%), Gaps = 4/149 (2%)
Query: 266 DQNQWSSVFCGIVSRAMTIEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRENYFVRYCK 325
D N+WS +F GIVS+A T++V+STG GN NG LQ+M AE QVPSPLVPTRE YF+RYCK
Sbjct: 81 DVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAELQVPSPLVPTREFYFLRYCK 140
Query: 326 QHSDGTWAVVDVSLDNLR----PSPTSKCRRRPSGCLIQELPNGYSKVIWVEHVEVDDRS 381
Q DG WAVVDVS+D ++ P+ +CRR PSGCLIQ++PNGYSKV WVEHVEVD++
Sbjct: 141 QLEDGLWAVVDVSIDGVQTAPPPASFVRCRRLPSGCLIQDMPNGYSKVTWVEHVEVDEKP 200
Query: 382 VHNIYKPLVNSGLAFGAKRWVATLDRQCE 410
VH +Y+ LV+SGLAFGA RWVATL RQCE
Sbjct: 201 VHLLYRYLVSSGLAFGATRWVATLQRQCE 229
|
This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells. Length = 229 |
| >gnl|CDD|216740 pfam01852, START, START domain | Back alignment and domain information |
|---|
| >gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|163064 TIGR02894, DNA_bind_RsfA, transcription factor, RsfA family | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 673 | |||
| cd08875 | 229 | START_ArGLABRA2_like C-terminal lipid-binding STAR | 100.0 | |
| KOG0842 | 307 | consensus Transcription factor tinman/NKX2-3, cont | 99.66 | |
| KOG0483 | 198 | consensus Transcription factor HEX, contains HOX a | 99.65 | |
| KOG0488 | 309 | consensus Transcription factor BarH and related HO | 99.59 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 99.58 | |
| KOG0485 | 268 | consensus Transcription factor NKX-5.1/HMX1, conta | 99.55 | |
| KOG0487 | 308 | consensus Transcription factor Abd-B, contains HOX | 99.54 | |
| KOG0843 | 197 | consensus Transcription factor EMX1 and related HO | 99.53 | |
| KOG0489 | 261 | consensus Transcription factor zerknullt and relat | 99.53 | |
| KOG0494 | 332 | consensus Transcription factor CHX10 and related H | 99.52 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 99.51 | |
| KOG0850 | 245 | consensus Transcription factor DLX and related pro | 99.5 | |
| KOG0484 | 125 | consensus Transcription factor PHOX2/ARIX, contain | 99.47 | |
| KOG0492 | 246 | consensus Transcription factor MSH, contains HOX d | 99.46 | |
| KOG0848 | 317 | consensus Transcription factor Caudal, contains HO | 99.44 | |
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.42 | |
| KOG2251 | 228 | consensus Homeobox transcription factor [Transcrip | 99.41 | |
| KOG0493 | 342 | consensus Transcription factor Engrailed, contains | 99.33 | |
| KOG0844 | 408 | consensus Transcription factor EVX1, contains HOX | 99.27 | |
| KOG0486 | 351 | consensus Transcription factor PTX1, contains HOX | 99.26 | |
| KOG3802 | 398 | consensus Transcription factor OCT-1, contains POU | 99.24 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.24 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.23 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.23 | |
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.23 | |
| KOG0491 | 194 | consensus Transcription factor BSH, contains HOX d | 99.19 | |
| KOG4577 | 383 | consensus Transcription factor LIM3, contains LIM | 99.12 | |
| KOG0847 | 288 | consensus Transcription factor, contains HOX domai | 99.05 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 98.9 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 98.85 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 98.72 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 98.67 | |
| KOG0849 | 354 | consensus Transcription factor PRD and related pro | 98.58 | |
| KOG1168 | 385 | consensus Transcription factor ACJ6/BRN-3, contain | 98.58 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 98.57 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 98.47 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 98.45 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 98.29 | |
| KOG0775 | 304 | consensus Transcription factor SIX and related HOX | 98.25 | |
| cd08905 | 209 | START_STARD1-like Cholesterol-binding START domain | 98.14 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 98.12 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 97.93 | |
| cd08902 | 202 | START_STARD4-like Lipid-binding START domain of ma | 97.9 | |
| KOG0774 | 334 | consensus Transcription factor PBX and related HOX | 97.78 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 97.76 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 97.72 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 97.58 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 97.46 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 97.46 | |
| KOG0490 | 235 | consensus Transcription factor, contains HOX domai | 97.39 | |
| KOG2252 | 558 | consensus CCAAT displacement protein and related h | 97.31 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 97.27 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 97.1 | |
| cd08910 | 207 | START_STARD2-like Lipid-binding START domain of ma | 96.97 | |
| cd08869 | 197 | START_RhoGAP C-terminal lipid-binding START domain | 96.92 | |
| cd08871 | 222 | START_STARD10-like Lipid-binding START domain of m | 96.8 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 96.78 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 96.51 | |
| cd08907 | 205 | START_STARD8-like C-terminal lipid-binding START d | 96.44 | |
| cd08872 | 235 | START_STARD11-like Ceramide-binding START domain o | 96.42 | |
| cd08873 | 235 | START_STARD14_15-like Lipid-binding START domain o | 96.22 | |
| KOG1146 | 1406 | consensus Homeobox protein [General function predi | 96.14 | |
| cd08904 | 204 | START_STARD6-like Lipid-binding START domain of ma | 95.69 | |
| cd08874 | 205 | START_STARD9-like C-terminal START domain of mamma | 95.41 | |
| cd08868 | 208 | START_STARD1_3_like Cholesterol-binding START doma | 95.27 | |
| cd00177 | 193 | START Lipid-binding START domain of mammalian STAR | 95.23 | |
| KOG0773 | 342 | consensus Transcription factor MEIS1 and related H | 95.21 | |
| cd08914 | 236 | START_STARD15-like Lipid-binding START domain of m | 94.9 | |
| cd08876 | 195 | START_1 Uncharacterized subgroup of the steroidoge | 94.74 | |
| smart00234 | 206 | START in StAR and phosphatidylcholine transfer pro | 94.66 | |
| cd08903 | 208 | START_STARD5-like Lipid-binding START domain of ma | 94.42 | |
| cd08913 | 240 | START_STARD14-like Lipid-binding START domain of m | 94.36 | |
| cd08877 | 215 | START_2 Uncharacterized subgroup of the steroidoge | 94.34 | |
| cd08909 | 205 | START_STARD13-like C-terminal lipid-binding START | 94.24 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 94.14 | |
| cd08908 | 204 | START_STARD12-like C-terminal lipid-binding START | 94.11 | |
| cd08914 | 236 | START_STARD15-like Lipid-binding START domain of m | 93.12 | |
| cd08867 | 206 | START_STARD4_5_6-like Lipid-binding START domain o | 92.44 | |
| cd08873 | 235 | START_STARD14_15-like Lipid-binding START domain o | 92.43 | |
| cd08906 | 209 | START_STARD3-like Cholesterol-binding START domain | 92.2 | |
| cd08875 | 229 | START_ArGLABRA2_like C-terminal lipid-binding STAR | 92.1 | |
| cd08902 | 202 | START_STARD4-like Lipid-binding START domain of ma | 91.08 | |
| cd08870 | 209 | START_STARD2_7-like Lipid-binding START domain of | 90.63 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 90.2 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 90.04 | |
| PF01852 | 206 | START: START domain; InterPro: IPR002913 START (St | 89.9 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 88.83 | |
| cd08864 | 208 | SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- | 87.59 | |
| cd08911 | 207 | START_STARD7-like Lipid-binding START domain of ma | 84.63 | |
| cd08910 | 207 | START_STARD2-like Lipid-binding START domain of ma | 83.85 | |
| KOG3623 | 1007 | consensus Homeobox transcription factor SIP1 [Tran | 82.02 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 81.69 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 81.4 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 80.93 |
| >cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-70 Score=555.09 Aligned_cols=172 Identities=66% Similarity=1.161 Sum_probs=167.4
Q ss_pred hHHHHHHHHHHHHHHHHhhcCCCCccc-----------------------------------------------------
Q 045292 239 KPMIVELAVAAMEEFLRMAQAGDPLWT----------------------------------------------------- 265 (673)
Q Consensus 239 ~~~~~~lA~~Am~El~~la~~~~plW~----------------------------------------------------- 265 (673)
|++|++||++||+||++||++++|||+
T Consensus 1 k~~~~~lA~~am~Ell~~a~~~~plWi~~~~~~~~~l~~dey~~~f~~~~~~~~~~~~~eASR~~glV~m~~~~lVe~lm 80 (229)
T cd08875 1 KSGLLELAEEAMDELLKLAQGGEPLWIKSPGMKPEILNPDEYERMFPRHGGSKPGGFTTEASRACGLVMMNAIKLVEILM 80 (229)
T ss_pred ChHHHHHHHHHHHHHHHHhccCCCCceecCCCCccccCHHHHhhcccCcCCCCCCCCeEEEEeeeEEEecCHHHHHHHHh
Confidence 578999999999999999999999999
Q ss_pred chhhhhcccccceeeeeEeEEeecccCCCCCCceeeeehhhcccCCCccCceeEEEEeeeecCCCeEEEEEEecCCCC--
Q 045292 266 DQNQWSSVFCGIVSRAMTIEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRENYFVRYCKQHSDGTWAVVDVSLDNLR-- 343 (673)
Q Consensus 266 D~~~w~~~Fp~ivarA~t~~vis~g~~g~~~G~lqlm~ael~~~SpLvp~Re~~fLRyck~~~~g~w~VvDvSld~~~-- 343 (673)
|.++|.++||+||+||+|++||++|.+|++||+|||||+|||+||||||+|||||||||||++||+|||||||+|+.+
T Consensus 81 D~~kW~~~Fp~iv~~a~tl~vistg~~g~~~G~lqlmyael~~pSpLVp~Re~~fLRyc~~l~dG~w~VvdvSld~~~~~ 160 (229)
T cd08875 81 DVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQTA 160 (229)
T ss_pred ChhhhhhhhhhhcceeeEEEEeeCCCCCCCCceehhhhhhcccCcccccCCeEEEEEEEEEeCCCeEEEEEEeecccccC
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999999874
Q ss_pred --CCCCcceeecCCcceEEecCCCceEEEEEEeeeecCccccccchhhhcchhhHHHHHHHHHHHHHHH
Q 045292 344 --PSPTSKCRRRPSGCLIQELPNGYSKVIWVEHVEVDDRSVHNIYKPLVNSGLAFGAKRWVATLDRQCE 410 (673)
Q Consensus 344 --~~~~~~~~~~PSGclIq~~~nG~skVtwVeH~e~d~~~v~~l~rpl~~sg~afga~rwla~Lqr~ce 410 (673)
+.+++||||+|||||||||+|||||||||||+|||++.+|.+||++++||+||||+||+++||||||
T Consensus 161 p~~~~~~r~~~~PSGcLIq~~~nG~SkVtwVeH~e~d~~~~~~l~~~l~~sg~AfgA~rw~a~lqRqce 229 (229)
T cd08875 161 PPPASFVRCRRLPSGCLIQDMPNGYSKVTWVEHVEVDEKPVHLLYRYLVSSGLAFGATRWVATLQRQCE 229 (229)
T ss_pred CCCCCccEEEEecCcEEEEECCCCceEEEEEEEEeccCCcccccchhhhhhhHHHHHHHHHHHHHHhcC
Confidence 3368999999999999999999999999999999999999999999999999999999999999997
|
This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells. |
| >KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >KOG0485 consensus Transcription factor NKX-5 | Back alignment and domain information |
|---|
| >KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG2251 consensus Homeobox transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0847 consensus Transcription factor, contains HOX domain [Transcription] | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins | Back alignment and domain information |
|---|
| >KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins | Back alignment and domain information |
|---|
| >cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains | Back alignment and domain information |
|---|
| >cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
| >KOG1146 consensus Homeobox protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins | Back alignment and domain information |
|---|
| >cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding | Back alignment and domain information |
|---|
| >cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins | Back alignment and domain information |
|---|
| >cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins | Back alignment and domain information |
|---|
| >KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >smart00234 START in StAR and phosphatidylcholine transfer protein | Back alignment and domain information |
|---|
| >cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins | Back alignment and domain information |
|---|
| >cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins | Back alignment and domain information |
|---|
| >cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family | Back alignment and domain information |
|---|
| >cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain | Back alignment and domain information |
|---|
| >cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins | Back alignment and domain information |
|---|
| >cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins | Back alignment and domain information |
|---|
| >cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins | Back alignment and domain information |
|---|
| >cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins | Back alignment and domain information |
|---|
| >cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins | Back alignment and domain information |
|---|
| >cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins | Back alignment and domain information |
|---|
| >cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily | Back alignment and domain information |
|---|
| >cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins | Back alignment and domain information |
|---|
| >cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins | Back alignment and domain information |
|---|
| >KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 673 | ||||
| 1ftt_A | 68 | Thyroid Transcription Factor 1 Homeodomain (Rattus | 6e-06 | ||
| 3a01_B | 67 | Crystal Structure Of Aristaless And Clawless Homeod | 2e-05 | ||
| 2l7m_P | 68 | Solution Structure Of The Pitx2 Homeodomain R24h Mu | 8e-05 | ||
| 2l7f_P | 68 | Solution Structure Of The Pitx2 Homeodomain Length | 9e-05 | ||
| 3a02_A | 60 | Crystal Structure Of Aristaless Homeodomain Length | 1e-04 | ||
| 1qry_A | 80 | Homeobox Protein Vnd (Ventral Nervous System Defect | 1e-04 | ||
| 3lnq_A | 58 | Structure Of Aristaless Homeodomain In Complex With | 1e-04 | ||
| 1nk2_P | 77 | VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES | 2e-04 | ||
| 3hdd_A | 60 | Engrailed Homeodomain Dna Complex Length = 60 | 2e-04 | ||
| 1hdd_C | 61 | Crystal Structure Of An Engrailed Homeodomain-Dna C | 2e-04 | ||
| 1zq3_P | 68 | Nmr Solution Structure Of The Bicoid Homeodomain Bo | 2e-04 | ||
| 1fjl_A | 81 | Homeodomain From The Drosophila Paired Protein Boun | 3e-04 | ||
| 2p81_A | 44 | Engrailed Homeodomain Helix-Turn-Helix Motif Length | 4e-04 | ||
| 2hdd_A | 61 | Engrailed Homeodomain Q50k Variant Dna Complex Leng | 5e-04 | ||
| 1p7j_A | 59 | Crystal Structure Of Engrailed Homeodomain Mutant K | 5e-04 | ||
| 1enh_A | 54 | Structural Studies Of The Engrailed Homeodomain Len | 5e-04 | ||
| 3d1n_I | 151 | Structure Of Human Brn-5 Transcription Factor In Co | 6e-04 | ||
| 2k40_A | 67 | Nmr Structure Of Hesx-1 Homeodomain Double Mutant R | 6e-04 | ||
| 1p7i_A | 59 | Crystal Structure Of Engrailed Homeodomain Mutant K | 7e-04 | ||
| 1du0_A | 57 | Engrailed Homeodomain Q50a Variant Dna Complex Leng | 8e-04 | ||
| 3a01_A | 93 | Crystal Structure Of Aristaless And Clawless Homeod | 9e-04 |
| >pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 | Back alignment and structure |
|
| >pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 | Back alignment and structure |
| >pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 | Back alignment and structure |
| >pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 | Back alignment and structure |
| >pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 | Back alignment and structure |
| >pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 | Back alignment and structure |
| >pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 | Back alignment and structure |
| >pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 | Back alignment and structure |
| >pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 | Back alignment and structure |
| >pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 | Back alignment and structure |
| >pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 | Back alignment and structure |
| >pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 | Back alignment and structure |
| >pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 | Back alignment and structure |
| >pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 | Back alignment and structure |
| >pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 | Back alignment and structure |
| >pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 | Back alignment and structure |
| >pdb|3D1N|I Chain I, Structure Of Human Brn-5 Transcription Factor In Complex With Corticotrophin-Releasing Hormone Gene Promoter Length = 151 | Back alignment and structure |
| >pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 | Back alignment and structure |
| >pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 | Back alignment and structure |
| >pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 | Back alignment and structure |
| >pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
Score = 90.5 bits (224), Expect = 2e-21
Identities = 26/113 (23%), Positives = 53/113 (46%), Gaps = 2/113 (1%)
Query: 2 FQPNTFESHHMFDMTRRSSESDLGKLKEDDYETKSGTETMEMEAPSGDDQDPSQHPKRKR 61
+ + D+T +S++ L++ E + + + +PS KRKR
Sbjct: 39 YSQSAISRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPS--KKRKR 96
Query: 62 YHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 114
T + I+ + A+F++ P P ++ E+++EL + V+ WF N+R +K
Sbjct: 97 RTSFTPQAIEALNAYFEKNPLPTGQEITEMAKELNYDREVVRVWFSNRRQTLK 149
|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 673 | |||
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.67 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.66 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 99.66 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.66 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.65 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.65 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.64 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.63 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.63 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.63 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.62 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.62 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.62 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.62 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.61 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.61 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.61 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.61 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.61 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.61 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.6 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.6 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.6 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.6 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.6 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.59 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.59 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.59 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.59 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.59 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.58 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.58 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.58 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.57 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.57 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.57 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.57 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.57 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.56 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.56 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.56 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.56 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.55 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.55 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.54 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.54 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.53 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.52 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.51 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.5 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.5 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.5 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.5 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.49 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.49 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.49 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.49 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.49 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.49 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.48 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.47 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.46 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.46 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.46 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.46 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.46 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.44 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.43 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.42 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.42 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.39 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.37 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.34 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.22 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.12 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.06 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.04 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 99.03 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 98.96 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 98.93 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 98.93 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 98.64 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 98.55 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.37 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 98.35 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 98.07 | |
| 2e3n_A | 255 | Lipid-transfer protein CERT; ceramide transfer, li | 97.8 | |
| 2r55_A | 231 | STAR-related lipid transfer protein 5; alpha and b | 96.77 | |
| 1jss_A | 224 | Stard4, cholesterol-regulated start protein 4; sta | 96.36 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 96.29 | |
| 3p0l_A | 221 | Steroidogenic acute regulatory protein, mitochond; | 95.52 | |
| 2pso_A | 237 | STAR-related lipid transfer protein 13; alpha and | 95.42 | |
| 1em2_A | 229 | MLN64 protein; beta barrel, lipid binding protein; | 95.27 | |
| 1ln1_A | 214 | PC-TP, phosphatidylcholine transfer protein; start | 95.12 | |
| 3fo5_A | 258 | Thioesterase, adipose associated, isoform BFIT2; o | 94.19 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 85.56 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 83.83 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 82.3 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 80.34 |
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.67 E-value=1.9e-17 Score=141.44 Aligned_cols=63 Identities=30% Similarity=0.455 Sum_probs=59.2
Q ss_pred CCCCCcccccccChhHHHHHHHhHhcCCCCChHHHHHHHHHhCCCcccEEeecccchhHHHHH
Q 045292 54 SQHPKRKRYHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKAQ 116 (673)
Q Consensus 54 ~~~kkrR~RtrfT~~Ql~~LE~~F~~~~~Ps~~~r~~LA~~LgLs~rQVkvWFQNRRaK~Kr~ 116 (673)
..+++||+|+.||.+|+..||..|+.++||+..+|.+||..|||+++||++||||||+|+|+.
T Consensus 13 ~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kk~ 75 (80)
T 2dmt_A 13 KAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKS 75 (80)
T ss_dssp CCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSCC
T ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHhhcc
Confidence 345678889999999999999999999999999999999999999999999999999999975
|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* | Back alignment and structure |
|---|
| >2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 | Back alignment and structure |
|---|
| >1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* | Back alignment and structure |
|---|
| >3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 673 | ||||
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 3e-18 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 8e-18 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 2e-17 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 6e-17 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 8e-17 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 8e-17 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 1e-16 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 2e-16 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 4e-15 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 7e-15 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 2e-14 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 2e-14 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 3e-14 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 3e-14 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 1e-13 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 2e-13 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 2e-13 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 2e-13 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 4e-13 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 5e-13 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 5e-13 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 7e-13 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 9e-13 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 9e-13 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 1e-12 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 6e-12 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 8e-12 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 1e-11 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 8e-11 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 2e-10 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 4e-10 | |
| d2ecca1 | 76 | a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H | 5e-10 | |
| d2jn6a1 | 89 | a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 | 0.001 |
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-a9 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 77.6 bits (191), Expect = 3e-18
Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 2/72 (2%)
Query: 49 DDQDPSQHPKRKRYHR--HTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWF 106
+ H + R R +T+ Q E+E F + +R E++R L L QVK WF
Sbjct: 2 NPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWF 61
Query: 107 QNKRTQMKAQHE 118
QN+R +MK ++
Sbjct: 62 QNRRMKMKKINK 73
|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 673 | |||
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.7 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.69 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.68 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.68 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.68 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.68 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.67 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.67 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.65 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.65 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.64 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.64 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.64 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.63 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.62 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.58 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.58 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.57 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.56 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.56 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.55 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.55 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.53 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.47 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.46 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.44 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.4 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.36 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.36 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.35 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.28 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 98.5 | |
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 98.1 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 98.05 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 97.77 | |
| d1em2a_ | 214 | Lipid transport domain of Mln64 {Human (Homo sapie | 95.35 | |
| d2psoa1 | 197 | Star-related lipid transfer protein 13 {Human (Hom | 95.31 | |
| d1jssa_ | 199 | Cholesterol-regulated Start protein 4 (Stard4). {M | 95.12 | |
| d1ln1a_ | 203 | Phosphatidylcholine transfer protein {Human (Homo | 94.29 |
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-a9 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.70 E-value=5.2e-18 Score=142.43 Aligned_cols=64 Identities=34% Similarity=0.420 Sum_probs=59.4
Q ss_pred CCCcccccccChhHHHHHHHhHhcCCCCChHHHHHHHHHhCCCcccEEeecccchhHHHHHHHH
Q 045292 56 HPKRKRYHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKAQHER 119 (673)
Q Consensus 56 ~kkrR~RtrfT~~Ql~~LE~~F~~~~~Ps~~~r~~LA~~LgLs~rQVkvWFQNRRaK~Kr~~~r 119 (673)
+.+||+|++||++|+..||..|+.++||+..+|.+||..|||+++||++||||||+|+|+..+.
T Consensus 11 ~~~rr~Rt~ft~~Ql~~Le~~F~~~~yPs~~~r~~LA~~l~l~~~qV~iWFqNrR~k~kr~~~~ 74 (77)
T d1pufa_ 11 RSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKD 74 (77)
T ss_dssp CTTSCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred CcCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCCHHHhhhhhhhhHHHHHHHHHH
Confidence 4456778999999999999999999999999999999999999999999999999999986554
|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|