Citrus Sinensis ID: 045338

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MVSRQVVFGNERTRAFSSATLISLYSQQQQVRFLEFLVCFCKMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
cccccccccccccccccccEEEEEEccccccEEEEHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEcccccEEEEccccccccHHHHHHHHHHHHHHHHHcc
ccccEEEEcccccccccccEEEEcccHHHHHHHHHHHHHHHHHHHcccEEcEcccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEccccccEEEccccccccHHHHHHHHHHHHHHHHHcc
mvsrqvvfgnertraFSSATLISLYSQQQQVRFLEFLVCFCKMtkrtkkagivgkygtrYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKavgiwgckdcgkvkaggaytlntASAVTVRSTIRRLREQTES
mvsrqvvfgnertrafssATLISLYSQQQQVRFLEFLVCFCKMtkrtkkagivgkygtrygasLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKvkaggaytlntasavtvrsTIRRLREQTES
MVSRQVVFGNERTRAFSSATLISLYSQQQQVRFLEFLVCFCKMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
*******F***RTRAFSSATLISLYSQQQQVRFLEFLVCFCKMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRST**********
********************L****SQQQQVRFLEFLVCFCKMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIR*LRE****
MVSRQVVFGNERTRAFSSATLISLYSQQQQVRFLEFLVCFCKMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
***RQVVFGNERTRAFSSATLISLYSQQQQVRFLEFLVCFCKMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQ***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSRQVVFGNERTRAFSSATLISLYSQQQQVRFLEFLVCFCKMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query134 2.2.26 [Sep-21-2011]
Q5QM9992 60S ribosomal protein L37 yes no 0.686 1.0 0.967 4e-46
Q9XHE492 60S ribosomal protein L37 N/A no 0.686 1.0 0.989 4e-46
Q9ZRS892 60S ribosomal protein L37 N/A no 0.679 0.989 0.967 2e-45
Q9SRK692 Putative 60S ribosomal pr yes no 0.686 1.0 0.945 1e-44
Q8RXU592 60S ribosomal protein L37 no no 0.686 1.0 0.923 8e-44
P4320993 60S ribosomal protein L37 N/A no 0.686 0.989 0.913 2e-42
A4S6Z492 60S ribosomal protein L37 yes no 0.679 0.989 0.802 1e-36
Q00VK492 60S ribosomal protein L37 yes no 0.679 0.989 0.791 7e-36
O6146292 60S ribosomal protein L37 N/A no 0.686 1.0 0.739 2e-33
Q54UG491 60S ribosomal protein L37 yes no 0.656 0.967 0.715 3e-31
>sp|Q5QM99|RL37A_ORYSJ 60S ribosomal protein L37a OS=Oryza sativa subsp. japonica GN=Os01g0679700 PE=1 SV=1 Back     alignment and function desciption
 Score =  182 bits (463), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 89/92 (96%), Positives = 92/92 (100%)

Query: 43  MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDC 102
           MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGK+AVKRKAVGIWGCKDC
Sbjct: 1   MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDC 60

Query: 103 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 134
           GKVKAGGAYT+NTASAVTVRSTIRRLREQTE+
Sbjct: 61  GKVKAGGAYTMNTASAVTVRSTIRRLREQTEA 92

Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q9XHE4|RL37A_GOSHI 60S ribosomal protein L37a OS=Gossypium hirsutum GN=RPL37A PE=3 SV=1 Back     alignment and function description
>sp|Q9ZRS8|RL37A_PSEMZ 60S ribosomal protein L37a OS=Pseudotsuga menziesii GN=RPL37A PE=3 SV=1 Back     alignment and function description
>sp|Q9SRK6|R37A1_ARATH Putative 60S ribosomal protein L37a-1 OS=Arabidopsis thaliana GN=RPL37AB PE=3 SV=1 Back     alignment and function description
>sp|Q8RXU5|R37A2_ARATH 60S ribosomal protein L37a-2 OS=Arabidopsis thaliana GN=RPL37AC PE=3 SV=1 Back     alignment and function description
>sp|P43209|RL37A_BRARA 60S ribosomal protein L37a OS=Brassica rapa GN=RPL37A PE=3 SV=2 Back     alignment and function description
>sp|A4S6Z4|RL37A_OSTLU 60S ribosomal protein L37a OS=Ostreococcus lucimarinus (strain CCE9901) GN=RPL37a PE=3 SV=1 Back     alignment and function description
>sp|Q00VK4|RL37A_OSTTA 60S ribosomal protein L37a OS=Ostreococcus tauri GN=RPL37a PE=3 SV=2 Back     alignment and function description
>sp|O61462|RL37A_CRYST 60S ribosomal protein L37a OS=Cryptochiton stelleri GN=RPL37A PE=3 SV=3 Back     alignment and function description
>sp|Q54UG4|RL37A_DICDI 60S ribosomal protein L37a OS=Dictyostelium discoideum GN=rpl37A PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
22542737792 PREDICTED: 60S ribosomal protein L37a-li 0.686 1.0 1.0 3e-45
41396844092 60S ribosomal protein L37a [Solanum tube 0.686 1.0 0.989 6e-45
5857827492 60S ribosomal protein L37a [Capsicum chi 0.686 1.0 0.989 6e-45
22412641592 predicted protein [Populus trichocarpa] 0.686 1.0 0.989 7e-45
22545330592 PREDICTED: 60S ribosomal protein L37a-li 0.686 1.0 0.989 9e-45
29782964692 60S ribosomal protein L37a [Arabidopsis 0.686 1.0 0.978 1e-44
255552928110 60S ribosomal protein L37a, putative [Ri 0.679 0.827 0.989 2e-44
297734652141 unnamed protein product [Vitis vinifera] 0.679 0.645 0.989 2e-44
35172698292 uncharacterized protein LOC100499850 [Gl 0.679 0.989 0.989 3e-44
11543917792 Os01g0679700 [Oryza sativa Japonica Grou 0.686 1.0 0.967 3e-44
>gi|225427377|ref|XP_002282974.1| PREDICTED: 60S ribosomal protein L37a-like [Vitis vinifera] gi|449432368|ref|XP_004133971.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449442329|ref|XP_004138934.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449461277|ref|XP_004148368.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449487554|ref|XP_004157684.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449505246|ref|XP_004162415.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] gi|449524647|ref|XP_004169333.1| PREDICTED: 60S ribosomal protein L37a-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%)

Query: 43  MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDC 102
           MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDC
Sbjct: 1   MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDC 60

Query: 103 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 134
           GKVKAGGAYTLNTASAVTVRSTIRRLREQTES
Sbjct: 61  GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|413968440|gb|AFW90557.1| 60S ribosomal protein L37a [Solanum tuberosum] Back     alignment and taxonomy information
>gi|58578274|emb|CAI48073.1| 60S ribosomal protein L37a [Capsicum chinense] Back     alignment and taxonomy information
>gi|224126415|ref|XP_002329548.1| predicted protein [Populus trichocarpa] gi|224136378|ref|XP_002326845.1| predicted protein [Populus trichocarpa] gi|224138784|ref|XP_002326689.1| predicted protein [Populus trichocarpa] gi|255571073|ref|XP_002526487.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|356504539|ref|XP_003521053.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|356511083|ref|XP_003524259.1| PREDICTED: 60S ribosomal protein L37a [Glycine max] gi|356520742|ref|XP_003529019.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|356563414|ref|XP_003549958.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|357477067|ref|XP_003608819.1| 60S ribosomal protein L37a [Medicago truncatula] gi|118483026|gb|ABK93424.1| unknown [Populus trichocarpa] gi|118484983|gb|ABK94356.1| unknown [Populus trichocarpa] gi|217071074|gb|ACJ83897.1| unknown [Medicago truncatula] gi|222834011|gb|EEE72488.1| predicted protein [Populus trichocarpa] gi|222835160|gb|EEE73595.1| predicted protein [Populus trichocarpa] gi|222870257|gb|EEF07388.1| predicted protein [Populus trichocarpa] gi|223534162|gb|EEF35878.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|355509874|gb|AES91016.1| 60S ribosomal protein L37a [Medicago truncatula] gi|388494042|gb|AFK35087.1| unknown [Medicago truncatula] gi|388514345|gb|AFK45234.1| unknown [Medicago truncatula] gi|388520787|gb|AFK48455.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225453305|ref|XP_002268650.1| PREDICTED: 60S ribosomal protein L37a-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297829646|ref|XP_002882705.1| 60S ribosomal protein L37a [Arabidopsis lyrata subsp. lyrata] gi|297328545|gb|EFH58964.1| 60S ribosomal protein L37a [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255552928|ref|XP_002517507.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|223543518|gb|EEF45049.1| 60S ribosomal protein L37a, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297734652|emb|CBI16703.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351726982|ref|NP_001236889.1| uncharacterized protein LOC100499850 [Glycine max] gi|356497076|ref|XP_003517390.1| PREDICTED: 60S ribosomal protein L37a-like [Glycine max] gi|255627121|gb|ACU13905.1| unknown [Glycine max] gi|388499112|gb|AFK37622.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|115439177|ref|NP_001043868.1| Os01g0679700 [Oryza sativa Japonica Group] gi|115465371|ref|NP_001056285.1| Os05g0557000 [Oryza sativa Japonica Group] gi|226505014|ref|NP_001147066.1| 60S ribosomal protein L37a [Zea mays] gi|242060548|ref|XP_002451563.1| hypothetical protein SORBIDRAFT_04g003900 [Sorghum bicolor] gi|242072670|ref|XP_002446271.1| hypothetical protein SORBIDRAFT_06g012050 [Sorghum bicolor] gi|242088791|ref|XP_002440228.1| hypothetical protein SORBIDRAFT_09g028040 [Sorghum bicolor] gi|357132620|ref|XP_003567927.1| PREDICTED: 60S ribosomal protein L37a-like [Brachypodium distachyon] gi|357135936|ref|XP_003569563.1| PREDICTED: 60S ribosomal protein L37a-like [Brachypodium distachyon] gi|75251381|sp|Q5QM99.1|RL37A_ORYSJ RecName: Full=60S ribosomal protein L37a gi|315113299|pdb|3IZR|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome gi|56202147|dbj|BAD73480.1| putative ribosomal protein L37a [Oryza sativa Japonica Group] gi|113533399|dbj|BAF05782.1| Os01g0679700 [Oryza sativa Japonica Group] gi|113579836|dbj|BAF18199.1| Os05g0557000 [Oryza sativa Japonica Group] gi|125553267|gb|EAY98976.1| hypothetical protein OsI_20934 [Oryza sativa Indica Group] gi|194695068|gb|ACF81618.1| unknown [Zea mays] gi|195605122|gb|ACG24391.1| 60S ribosomal protein L37a [Zea mays] gi|195607006|gb|ACG25333.1| 60S ribosomal protein L37a [Zea mays] gi|195610910|gb|ACG27285.1| 60S ribosomal protein L37a [Zea mays] gi|195618522|gb|ACG31091.1| 60S ribosomal protein L37a [Zea mays] gi|195621146|gb|ACG32403.1| 60S ribosomal protein L37a [Zea mays] gi|195622916|gb|ACG33288.1| 60S ribosomal protein L37a [Zea mays] gi|195625062|gb|ACG34361.1| 60S ribosomal protein L37a [Zea mays] gi|195626918|gb|ACG35289.1| 60S ribosomal protein L37a [Zea mays] gi|195658085|gb|ACG48510.1| 60S ribosomal protein L37a [Zea mays] gi|195658103|gb|ACG48519.1| 60S ribosomal protein L37a [Zea mays] gi|215765281|dbj|BAG86978.1| unnamed protein product [Oryza sativa Japonica Group] gi|215767573|dbj|BAG99801.1| unnamed protein product [Oryza sativa Japonica Group] gi|218188844|gb|EEC71271.1| hypothetical protein OsI_03269 [Oryza sativa Indica Group] gi|222632516|gb|EEE64648.1| hypothetical protein OsJ_19502 [Oryza sativa Japonica Group] gi|223972803|gb|ACN30589.1| unknown [Zea mays] gi|241931394|gb|EES04539.1| hypothetical protein SORBIDRAFT_04g003900 [Sorghum bicolor] gi|241937454|gb|EES10599.1| hypothetical protein SORBIDRAFT_06g012050 [Sorghum bicolor] gi|241945513|gb|EES18658.1| hypothetical protein SORBIDRAFT_09g028040 [Sorghum bicolor] gi|300681508|emb|CBH32602.1| 60S ribosomal protein L37a, expressed [Triticum aestivum] gi|326496112|dbj|BAJ90677.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326497275|dbj|BAK02222.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326526641|dbj|BAK00709.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|413926561|gb|AFW66493.1| 60S ribosomal protein L37a isoform 1 [Zea mays] gi|413926562|gb|AFW66494.1| 60S ribosomal protein L37a isoform 2 [Zea mays] gi|413935645|gb|AFW70196.1| 60S ribosomal protein L37a [Zea mays] gi|414587630|tpg|DAA38201.1| TPA: 60S ribosomal protein L37a [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
TAIR|locus:208553292 AT3G10950 [Arabidopsis thalian 0.686 1.0 0.945 1e-43
TAIR|locus:50500640692 AT3G60245 [Arabidopsis thalian 0.679 0.989 0.934 5.7e-43
DICTYBASE|DDB_G028109391 rpl37A "ribosomal protein" [Di 0.656 0.967 0.715 2e-31
UNIPROTKB|P3204692 RPL37A "60S ribosomal protein 0.656 0.956 0.727 3.3e-31
WB|WBGene0000445691 rpl-43 [Caenorhabditis elegans 0.679 1.0 0.714 3.3e-31
UNIPROTKB|Q3MIC092 RPL37A "60S ribosomal protein 0.656 0.956 0.715 6.9e-31
UNIPROTKB|P6151392 RPL37A "60S ribosomal protein 0.656 0.956 0.715 6.9e-31
MGI|MGI:9806892 Rpl37a "ribosomal protein L37a 0.656 0.956 0.715 6.9e-31
RGD|156118192 Rpl37a-ps1 "ribosomal protein 0.656 0.956 0.715 6.9e-31
UNIPROTKB|P6151592 Rpl37a-ps1 "Putative 60S ribos 0.656 0.956 0.715 6.9e-31
TAIR|locus:2085532 AT3G10950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 461 (167.3 bits), Expect = 1.0e-43, P = 1.0e-43
 Identities = 87/92 (94%), Positives = 90/92 (97%)

Query:    43 MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDC 102
             MTKRTKKA IVGKYGTRYGASLRKQIKKMEVSQH+KYFCEFCGKY+VKRK VGIWGCKDC
Sbjct:     1 MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDC 60

Query:   103 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 134
             GKVKAGGAYT+NTASAVTVRSTIRRLREQTES
Sbjct:    61 GKVKAGGAYTMNTASAVTVRSTIRRLREQTES 92
GO:0003735 "structural constituent of ribosome" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005840 "ribosome" evidence=IEA;ISS
GO:0006412 "translation" evidence=IEA;ISS
GO:0042254 "ribosome biogenesis" evidence=ISS
GO:0022625 "cytosolic large ribosomal subunit" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:505006406 AT3G60245 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281093 rpl37A "ribosomal protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P32046 RPL37A "60S ribosomal protein L37a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00004456 rpl-43 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MIC0 RPL37A "60S ribosomal protein L37a" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61513 RPL37A "60S ribosomal protein L37a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:98068 Rpl37a "ribosomal protein L37a" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1561181 Rpl37a-ps1 "ribosomal protein L37a, pseudogene 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61515 Rpl37a-ps1 "Putative 60S ribosomal protein L37a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4S6Z4RL37A_OSTLUNo assigned EC number0.80210.67910.9891yesno
Q9U2A8RL37A_CAEELNo assigned EC number0.71420.67911.0yesno
P61513RL37A_HUMANNo assigned EC number0.71590.65670.9565yesno
P61515RL37P_RATNo assigned EC number0.71590.65670.9565yesno
P61514RL37A_MOUSENo assigned EC number0.71590.65670.9565yesno
Q5QM99RL37A_ORYSJNo assigned EC number0.96730.68651.0yesno
Q8RXU5R37A2_ARATHNo assigned EC number0.92390.68651.0nono
O96184RL37A_PLAF7No assigned EC number0.62630.67910.9479yesno
P0CX25RL43A_YEASTNo assigned EC number0.66300.68651.0yesno
P0CX26RL43B_YEASTNo assigned EC number0.66300.68651.0yesno
Q7SZB4RL37A_XENLANo assigned EC number0.71590.65670.9565N/Ano
Q00VK4RL37A_OSTTANo assigned EC number0.79120.67910.9891yesno
Q9VMU4RL37A_DROMENo assigned EC number0.65930.67910.9891yesno
Q9HGL8RL43A_SCHPONo assigned EC number0.64510.67910.9680yesno
Q9SRK6R37A1_ARATHNo assigned EC number0.94560.68651.0yesno
Q9XHE4RL37A_GOSHINo assigned EC number0.98910.68651.0N/Ano
P32046RL37A_CHICKNo assigned EC number0.72720.65670.9565yesno
Q6FRG6RL43_CANGANo assigned EC number0.65210.68651.0yesno
Q54UG4RL37A_DICDINo assigned EC number0.71590.65670.9670yesno
Q9ZRS8RL37A_PSEMZNo assigned EC number0.96700.67910.9891N/Ano
P43209RL37A_BRARANo assigned EC number0.91390.68650.9892N/Ano
O61462RL37A_CRYSTNo assigned EC number0.73910.68651.0N/Ano
Q3MIC0RL37A_BOVINNo assigned EC number0.71590.65670.9565yesno
Q751L1RL43_ASHGONo assigned EC number0.68470.68651.0yesno
Q5RBF9RL37A_PONABNo assigned EC number0.71590.65670.9565yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
PTZ0025590 PTZ00255, PTZ00255, 60S ribosomal protein L37a; Pr 3e-47
pfam0178090 pfam01780, Ribosomal_L37ae, Ribosomal L37ae protei 3e-47
TIGR0028092 TIGR00280, L37a, ribosomal protein L37a 3e-29
COG199789 COG1997, RPL43A, Ribosomal protein L37AE/L43A [Tra 2e-28
PRK0397690 PRK03976, rpl37ae, 50S ribosomal protein L37Ae; Re 2e-26
>gnl|CDD|240332 PTZ00255, PTZ00255, 60S ribosomal protein L37a; Provisional Back     alignment and domain information 
 Score =  147 bits (372), Expect = 3e-47
 Identities = 68/89 (76%), Positives = 77/89 (86%)

Query: 43  MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDC 102
           M KRTKK GI GKYGTRYGASLRKQIKK+E+SQH+KYFC FCGK+AVKR+AVGIW CK C
Sbjct: 1   MAKRTKKVGITGKYGTRYGASLRKQIKKIEISQHAKYFCPFCGKHAVKRQAVGIWRCKGC 60

Query: 103 GKVKAGGAYTLNTASAVTVRSTIRRLREQ 131
            K  AGGA+TL+T +A TVRSTIRRLR+ 
Sbjct: 61  KKTVAGGAWTLSTPAASTVRSTIRRLRKL 89

Length = 90
>gnl|CDD|216695 pfam01780, Ribosomal_L37ae, Ribosomal L37ae protein family Back     alignment and domain information
>gnl|CDD|232904 TIGR00280, L37a, ribosomal protein L37a Back     alignment and domain information
>gnl|CDD|224908 COG1997, RPL43A, Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235183 PRK03976, rpl37ae, 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 134
PTZ0025590 60S ribosomal protein L37a; Provisional 100.0
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 100.0
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 100.0
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 100.0
KOG040292 consensus 60S ribosomal protein L37 [Translation, 100.0
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 100.0
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 96.98
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 96.95
PRK0971064 lar restriction alleviation and modification prote 96.14
PRK0043250 30S ribosomal protein S27ae; Validated 95.82
PF1435461 Lar_restr_allev: Restriction alleviation protein L 95.65
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 95.5
PHA0062659 hypothetical protein 95.43
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 95.09
PRK00464154 nrdR transcriptional regulator NrdR; Validated 94.7
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 94.7
PF0180797 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zin 94.67
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 94.19
smart0040055 ZnF_CHCC zinc finger. 93.49
smart0066152 RPOL9 RNA polymerase subunit 9. 93.44
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 93.03
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 92.97
COG0675364 Transposase and inactivated derivatives [DNA repli 92.94
PF08646146 Rep_fac-A_C: Replication factor-A C terminal domai 92.3
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 92.05
TIGR0383146 YgiT_finger YgiT-type zinc finger domain. This dom 91.33
PF1178136 RRN7: RNA polymerase I-specific transcription init 91.21
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 90.6
PRK05667 580 dnaG DNA primase; Validated 90.27
PRK00423 310 tfb transcription initiation factor IIB; Reviewed 90.24
PHA02942383 putative transposase; Provisional 90.17
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 89.51
TIGR01391 415 dnaG DNA primase, catalytic core. This protein con 89.49
TIGR03830127 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he 89.44
PRK12366637 replication factor A; Reviewed 89.11
PRK1489299 putative transcription elongation factor Elf1; Pro 88.18
cd04476166 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds cor 87.69
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 87.62
smart00531147 TFIIE Transcription initiation factor IIE. 87.4
PHA02540 337 61 DNA primase; Provisional 87.0
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 86.8
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 86.31
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 86.3
PF0381136 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR0 85.94
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 85.82
PRK11823 446 DNA repair protein RadA; Provisional 85.37
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 84.79
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 84.64
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 84.48
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 84.31
TIGR00244147 transcriptional regulator NrdR. Members of this al 84.31
COG1571421 Predicted DNA-binding protein containing a Zn-ribb 84.19
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 83.97
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 82.84
PF14353128 CpXC: CpXC protein 82.8
COG1405 285 SUA7 Transcription initiation factor TFIIIB, Brf1 82.57
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 82.55
COG3677129 Transposase and inactivated derivatives [DNA repli 82.44
PF0877273 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik 82.33
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 82.03
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 81.31
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 80.68
PF11672102 DUF3268: Protein of unknown function (DUF3268); In 80.64
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 80.37
PRK08402355 replication factor A; Reviewed 80.28
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.6e-50  Score=289.50  Aligned_cols=90  Identities=76%  Similarity=1.211  Sum_probs=88.7

Q ss_pred             hhccceeeeeccCCccccCchhhHhHHHHHHhhhcccccCCCCceeeEEeeeeeeeeCCCCeeEeccccccccchHHHHH
Q 045338           43 MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVR  122 (134)
Q Consensus        43 MakrTKKVgi~GkfGtRYGaslRK~vkkIE~sqhakY~CpfCGk~~VKR~avGIW~CkkCgkt~AGGAy~p~T~~~~tvk  122 (134)
                      |++|||||||+||||+|||++|||+|+|||++||++|+|||||+++|+|.++|||+|++|+++||||||+|+||++.++.
T Consensus         1 MakrtkkvG~~GrfG~RYG~slRK~v~kie~~q~a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AGGAy~~~T~~~~t~~   80 (90)
T PTZ00255          1 MAKRTKKVGITGKYGTRYGASLRKQIKKIEISQHAKYFCPFCGKHAVKRQAVGIWRCKGCKKTVAGGAWTLSTPAASTVR   80 (90)
T ss_pred             CCCcCceeeecCCCcCccCHHHHHHHHHHHHHHhCCccCCCCCCCceeeeeeEEEEcCCCCCEEeCCccccccchhHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhh
Q 045338          123 STIRRLREQT  132 (134)
Q Consensus       123 ~~Irrl~e~~  132 (134)
                      ++|+||+|++
T Consensus        81 ~~irr~~e~~   90 (90)
T PTZ00255         81 STIRRLRKLK   90 (90)
T ss_pred             HHHHHHHhcC
Confidence            9999999974

>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PF01807 zf-CHC2: CHC2 zinc finger; InterPro: IPR002694 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>smart00400 ZnF_CHCC zinc finger Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF08646 Rep_fac-A_C: Replication factor-A C terminal domain; InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03831 YgiT_finger YgiT-type zinc finger domain Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK05667 dnaG DNA primase; Validated Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>PHA02942 putative transposase; Provisional Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>TIGR01391 dnaG DNA primase, catalytic core Back     alignment and domain information
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70) Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PHA02540 61 DNA primase; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF03811 Zn_Tnp_IS1: InsA N-terminal domain; InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR00244 transcriptional regulator NrdR Back     alignment and domain information
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11672 DUF3268: Protein of unknown function (DUF3268); InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150 Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
3izr_m92 Localization Of The Large Subunit Ribosomal Protein 3e-47
1ysh_D73 Localization And Dynamic Behavior Of Ribosomal Prot 1e-36
2zkr_z92 Structure Of A Mammalian Ribosomal 60s Subunit With 2e-31
3izs_m92 Localization Of The Large Subunit Ribosomal Protein 1e-30
3zf7_o93 High-resolution Cryo-electron Microscopy Structure 5e-30
1s1i_991 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 6e-30
4a17_Y103 T.Thermophila 60s Ribosomal Subunit In Complex With 6e-28
3jyw_972 Structure Of The 60s Proteins For Eukaryotic Riboso 7e-22
3j21_i83 Promiscuous Behavior Of Proteins In Archaeal Riboso 4e-13
3cc2_Z116 The Refined Crystal Structure Of The Haloarcula Mar 1e-10
3cpw_Y92 The Structure Of The Antibiotic Linezolid Bound To 2e-10
2qa4_Z92 A More Complete Structure Of The The L7L12 STALK OF 2e-10
1ffk_W73 Crystal Structure Of The Large Ribosomal Subunit Fr 2e-09
1yhq_Z83 Crystal Structure Of Azithromycin Bound To The G209 4e-09
1jj2_Y73 Fully Refined Crystal Structure Of The Haloarcula M 7e-08
1s72_Z73 Refined Crystal Structure Of The Haloarcula Marismo 7e-08
3g4s_Z73 Co-Crystal Structure Of Tiamulin Bound To The Large 8e-08
>pdb|3IZR|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 92 Back     alignment and structure 
Iteration: 1

 Score =  182 bits (463), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 89/92 (96%), Positives = 92/92 (100%)
Query: 43  MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDC 102
           MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGK+AVKRKAVGIWGCKDC
Sbjct: 1   MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDC 60
Query: 103 GKVKAGGAYTLNTASAVTVRSTIRRLREQTES 134
           GKVKAGGAYT+NTASAVTVRSTIRRLREQTE+
Sbjct: 61  GKVKAGGAYTMNTASAVTVRSTIRRLREQTEA 92
>pdb|1YSH|D Chain D, Localization And Dynamic Behavior Of Ribosomal Protein L30e Length = 73 Back     alignment and structure
>pdb|2ZKR|ZZ Chain z, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 92 Back     alignment and structure
>pdb|3IZS|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 92 Back     alignment and structure
>pdb|3ZF7|OO Chain o, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 93 Back     alignment and structure
>pdb|1S1I|9 Chain 9, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 91 Back     alignment and structure
>pdb|4A17|Y Chain Y, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 103 Back     alignment and structure
>pdb|3JYW|9 Chain 9, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 72 Back     alignment and structure
>pdb|3J21|II Chain i, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 83 Back     alignment and structure
>pdb|3CC2|Z Chain Z, The Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution With Rrna Sequence For The 23s Rrna And Genome-Derived Sequences For R-Proteins Length = 116 Back     alignment and structure
>pdb|3CPW|Y Chain Y, The Structure Of The Antibiotic Linezolid Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui Length = 92 Back     alignment and structure
>pdb|2QA4|Z Chain Z, A More Complete Structure Of The The L7L12 STALK OF THE Haloarcula Marismortui 50s Large Ribosomal Subunit Length = 92 Back     alignment and structure
>pdb|1FFK|W Chain W, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure
>pdb|1YHQ|Z Chain Z, Crystal Structure Of Azithromycin Bound To The G2099a Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui Length = 83 Back     alignment and structure
>pdb|1JJ2|Y Chain Y, Fully Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure
>pdb|1S72|Z Chain Z, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure
>pdb|3G4S|Z Chain Z, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 1e-43
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 2e-43
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 3e-42
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 2e-41
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 9e-38
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 5e-33
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 2e-31
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 3e-04
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Length = 116 Back     alignment and structure
 Score =  138 bits (349), Expect = 1e-43
 Identities = 30/92 (32%), Positives = 46/92 (50%)

Query: 42  KMTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKD 101
            M  ++ K G  G++G RYG   R+++ ++E   +  + C  CG+  V R+  GIW C  
Sbjct: 24  TMASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSY 83

Query: 102 CGKVKAGGAYTLNTASAVTVRSTIRRLREQTE 133
           C     GG+Y   T    TVR +IR    + E
Sbjct: 84  CDYKFTGGSYKPETPGGKTVRRSIRAALSEDE 115
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Length = 103 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Length = 83 Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Length = 73 Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Length = 72 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 100.0
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 100.0
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 100.0
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 100.0
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 100.0
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 100.0
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 100.0
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 100.0
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 98.61
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 95.66
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 94.92
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 94.57
1d0q_A103 DNA primase; zinc-binding motif, protein, transfer 94.46
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 94.35
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 94.25
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 93.6
3u50_C172 Telomerase-associated protein 82; TEB1, processivi 92.94
1l1o_C181 Replication protein A 70 kDa DNA-binding subunit; 92.54
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 92.17
2au3_A 407 DNA primase; zinc ribbon, toprim, RNA polymerase, 91.68
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 90.74
1vd4_A62 Transcription initiation factor IIE, alpha subunit 90.2
1nui_A 255 DNA primase/helicase; zinc-biding domain, toprim f 90.11
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 90.02
4bbr_M 345 Transcription initiation factor IIB; RNA polymeras 90.01
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 89.98
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 89.93
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 89.7
4gop_C444 Putative uncharacterized protein; OB fold, ssDNA b 89.01
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 88.33
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 88.05
2ds5_A51 CLPX, ATP-dependent CLP protease ATP-binding subun 87.63
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 87.59
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 86.86
2lv2_A85 Insulinoma-associated protein 1; structural genomi 86.7
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 86.57
1ovx_A67 ATP-dependent CLP protease ATP-binding subunit CL; 85.8
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 85.72
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 85.59
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 85.14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 84.6
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 84.08
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 83.91
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 83.81
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 83.58
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 83.44
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 83.34
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 83.04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 82.76
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 82.59
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 82.35
3k7a_M 345 Transcription initiation factor IIB; RNA polymeras 81.53
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 80.66
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 80.53
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 80.09
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 80.48
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>1d0q_A DNA primase; zinc-binding motif, protein, transferase; HET: DNA; 1.71A {Geobacillus stearothermophilus} SCOP: g.41.3.2 Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>1l1o_C Replication protein A 70 kDa DNA-binding subunit; eukaryotic SSB, ssDNA binding protein, OB-fold; 2.80A {Homo sapiens} SCOP: b.40.4.3 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>2au3_A DNA primase; zinc ribbon, toprim, RNA polymerase, DNA replication, transf; HET: DNA; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gop_C Putative uncharacterized protein; OB fold, ssDNA binding, DNA binding protein-DNA complex; HET: DNA; 3.10A {Ustilago maydis} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ds5_A CLPX, ATP-dependent CLP protease ATP-binding subunit CLPX; treble cleft zinc finger, metal binding protein, protein binding; HET: PG4; 1.50A {Escherichia coli} SCOP: g.39.1.11 PDB: 2ds6_A 2ds8_A 2ds7_A Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ovx_A ATP-dependent CLP protease ATP-binding subunit CL; treble CLEF zinc finger, homodimer, metal binding protein; NMR {Escherichia coli} SCOP: g.39.1.11 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 134
d1vqoz173 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archae 3e-34
d1jj2y_73 g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Ha 1e-33
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 73 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L37ae
domain: Ribosomal protein L37ae
species: Archaeon Haloarcula marismortui [TaxId: 2238]

 Score =  112 bits (281), Expect = 3e-34
 Identities = 24/71 (33%), Positives = 37/71 (52%)

Query: 54  GKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTL 113
           G++G RYG   R+++ ++E   +  + C  CG+  V R+  GIW C  C     GG+Y  
Sbjct: 3   GRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKP 62

Query: 114 NTASAVTVRST 124
            T    TVR +
Sbjct: 63  ETPGGKTVRRS 73
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 100.0
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 100.0
d1wiia_85 Hypothetical UPF0222 protein MGC4549 {Mouse (Mus m 93.11
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 90.74
d1d0qa_102 Zinc-binding domain of DNA primase {Bacillus stear 90.67
d1l1oc_178 Replication protein A 70 KDa subunit (RPA70) {Huma 90.29
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 89.17
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 88.25
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 85.89
d2ds5a138 ClpX chaperone zinc binding domain {Escherichia co 85.04
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 84.02
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 83.54
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 83.08
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 82.93
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 82.58
d2cota238 Zinc finger and SCAN domain-containing protein 16, 82.17
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 82.04
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 81.62
d2cona166 RNA-binding protein NOB1 (Nin one binding) {Mouse 81.36
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 81.22
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L37ae
domain: Ribosomal protein L37ae
species: Archaeon Haloarcula marismortui [TaxId: 2238]

Probab=100.00  E-value=2.3e-42  Score=239.20  Aligned_cols=72  Identities=35%  Similarity=0.755  Sum_probs=70.5

Q ss_pred             ccCCccccCchhhHhHHHHHHhhhcccccCCCCceeeEEeeeeeeeeCCCCeeEeccccccccchHHHHHHH
Q 045338           53 VGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKYAVKRKAVGIWGCKDCGKVKAGGAYTLNTASAVTVRST  124 (134)
Q Consensus        53 ~GkfGtRYGaslRK~vkkIE~sqhakY~CpfCGk~~VKR~avGIW~CkkCgkt~AGGAy~p~T~~~~tvk~~  124 (134)
                      +||||+|||++|||+|++||++||++|+|||||+++|+|+++|||+|++|+++||||||+|+||++.+|+++
T Consensus         2 TGrfG~RYG~slRk~v~kie~~q~~ky~Cp~Cgk~~vkR~a~GIW~C~kC~~~~AGgAy~p~T~a~~tv~~~   73 (73)
T d1jj2y_           2 TGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA   73 (73)
T ss_dssp             GGGGTTCSCHHHHHHHHHHHHHHHSCBCCSSSCCSCEEEEETTEEEETTTCCEEECCSSSSSCHHHHHHHHC
T ss_pred             CCccccccCHHHHHHHHHHHHHhcCCccCCCCCCCceEEEEEEEEECCCCCCEEeCccceecchHHhhhccC
Confidence            599999999999999999999999999999999999999999999999999999999999999999999874
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1d0qa_ g.41.3.2 (A:) Zinc-binding domain of DNA primase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l1oc_ b.40.4.3 (C:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2ds5a1 g.39.1.11 (A:11-48) ClpX chaperone zinc binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure