Citrus Sinensis ID: 045355


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900
MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKSEAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTLEDDYPPDNERCEHGEMLLYKISLLEECGSFERALAEMHKKESKIVDKLAYKEQEVSLLVKIGRLEEAAELYRALLSMNPDNYSYYEGLQKCLGLYRDNGNYSSGEIDELDALYKSLAQQYTWSSAVKRIPLDFLQGEKFREAAFNYVRPLLTKGVPSLFSDLSPLYDQPGKADILEQLILELEHSIGTTGKYPGREEKEPPSTLLWTLFFLAQHYDRRGQYDVALSKIDEAIEHTPTVIDLYSVKSRILKHAGDLAAAATLADEARCMDLADRYVNSECVKRMLQADQVSLAEKTAALFTKDGDQHNNLHDMQCMWYELASGESYFRQGDLGRALKKFLAVEKHYADITEDQFDFHSYCLRKMTLRAYVEMLKFQDRLHSHAYFHKAAAGAIRCYIKLFDSPPRSTTEEDDDKADLPPSQKKKLKQKQRKAEARAKKEAEGKNEESSASGVSKSGKRHVKPVDPDPHGEKLLQVEDPLSEATKYLKLLQKNSPDSLETHLLSFEVNIRKQKILLALQAVKHLLRLNAEDPESHRCLIRFFHKVDLMTAPATDTEKLIWSVLEAERPAISQLQEKSLIEANKFFLHKHEDSLMHRAAAAEMLFVLETNKKSEAVQLIEDSTNNLAPTNGALGSVREWKLRDSIAVHKLLETVLADQDAALRWKTRCAEYFPYSTYFEGKHSGMYNTAYKHMLTNPENGSASQAGVSADTIASNGKLEAFKNLAIST
cccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccccHHccccccccccccccccccccccccccccccccccccc
*G*SLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKSEAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTLEDDYPPDNERCEHGEMLLYKISLLEECGSFERALAEMHKKESKIVDKLAYKEQEVSLLVKIGRLEEAAELYRALLSMNPDNYSYYEGLQKCLGLYRDNGNYSSGEIDELDALYKSLAQQYTWSSAVKRIPLDFLQGEKFREAAFNYVRPLLTKGVPSLFSDLSPLYDQPGKADILEQLILELEHSIGTTGKYPGREEKEPPSTLLWTLFFLAQHYDRRGQYDVALSKIDEAIEHTPTVIDLYSVKSRILKHAGDLAAAATLADEARCMDLADRYVNSECVKRMLQADQVSLAEKTAALFTKDGDQHNNLHDMQCMWYELASGESYFRQGDLGRALKKFLAVEKHYADITEDQFDFHSYCLRKMTLRAYVEMLKFQDRLHSHAYFHKAAAGAIRCYIKLFDSP***********************************************************VDPDPHGEKLLQVEDPLSEATKYLKLLQKNSPDSLETHLLSFEVNIRKQKILLALQAVKHLLRLNAEDPESHRCLIRFFHKVDLMTAPATDTEKLIWSVLEAERPAISQLQEKSLIEANKFFLHKHEDSLMHRAAAAEMLFVLETNKK*EAVQLIEDSTNNLAPTNGALGSVREWKLRDSIAVHKLLETVLADQDAALRWKTRCAEYFPYSTYFEGK***********************************KLEAFKNLAIS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGASLPSKDANLFKLIVKSYETKQYKKGLKAADAILKKFPEHGETLSMKGLTLNCMDRKSEAYELVRLGVKNDIKSHVCWHVYGLLYRSDREYREAIKCYRNALRIDPDNIEILRDLSLLQAQMRDLTGFVETRQQLLTLKPNHRMNWIGFAVSHHLNSNGSKAVEILEAYEGTLEDDYPPDNERCEHGEMLLYKISLLEECGSFERALAEMHKKESKIVDKLAYKEQEVSLLVKIGRLEEAAELYRALLSMNPDNYSYYEGLQKCLGLYRDNGNYSSGEIDELDALYKSLAQQYTWSSAVKRIPLDFLQGEKFREAAFNYVRPLLTKGVPSLFSDLSPLYDQPGKADILEQLILELEHSIGTTGKYPGREEKEPPSTLLWTLFFLAQHYDRRGQYDVALSKIDEAIEHTPTVIDLYSVKSRILKHAGDLAAAATLADEARCMDLADRYVNSECVKRMLQADQVSLAEKTAALFTKDGDQHNNLHDMQCMWYELASGESYFRQGDLGRALKKFLAVEKHYADITEDQFDFHSYCLRKMTLRAYVEMLKFQDRLHSHAYFHKAAAGAIRCYIKLFDSPPRSTTEEDDDKADLPPSQKKKLxxxxxxxxxxxxxxxxxxxxxSSASGVSKSGKRHVKPVDPDPHGEKLLQVEDPLSEATKYLKLLQKNSPDSLETHLLSFEVNIRKQKILLALQAVKHLLRLNAEDPESHRCLIRFFHKVDLMTAPATDTEKLIWSVLEAERPAISQLQEKSLIEANKFFLHKHEDSLMHRAAAAEMLFVLETNKKSEAVQLIEDSTNNLAPTNGALGSVREWKLRDSIAVHKLLETVLADQDAALRWKTRCAEYFPYSTYFEGKHSGMYNTAYKHMLTNPENGSASQAGVSADTIASNGKLEAFKNLAIST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-alpha-acetyltransferase 16, NatA auxiliary subunit May belong to a complex displaying N-terminal acetyltransferase activity.probableQ9DBB4
N-alpha-acetyltransferase 16, NatA auxiliary subunit May belong to a complex displaying N-terminal acetyltransferase activity.probableQ6N069
N-alpha-acetyltransferase 15, NatA auxiliary subunit The NAA10-NAA15 complex displays alpha (N-terminal) acetyltransferase activity that may be important for vascular, hematopoietic and neuronal growth and development. Required to control retinal neovascularization in adult ocular endothelial cells. In complex with XRCC6 and XRCC5 (Ku80), up-regulates transcription from the osteocalcin promoter.probableQ5R4J9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 9-105,120-299,381-525
View the alignment between query and template
View the model in PyMOL
Template: 2GW1, chain A
Confidence level:very confident
Coverage over the Query: 8-298,331-452
View the alignment between query and template
View the model in PyMOL
Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 9-299,381-529,559-570,648-714
View the alignment between query and template
View the model in PyMOL
Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 9-458
View the alignment between query and template
View the model in PyMOL