Citrus Sinensis ID: 045361

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15

LPTQTNRASHLRPLCAVEAPEKIEKLATEISSLTLQEVCNLVDYLQDKLGVSAAAFAPAAAVGVAPGAPGAEAPASVEEEKTEFDVVIDEVPSNARIAVIKAVRTLTNLALKEAKDLIEGLPKKFKEGVSKDDAEAAKKQLEEAGAKF

ccccccccccccccHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccHHcccccccccccccccccccccccEEEEccccccccEEEEEHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccc

*************LCAVEAPEKIEKLATEISSLTLQEVCNLVDYLQDKLGVSAAAFAPAAAVGVA************EEEKTEFDVVIDEVPSNARIAVIKAVRTLTNLALKEAKDLIEGLPKKFKEGVSKDDAEAAKKQLEEAGA**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

LPTQTNRASHLRPLCAVEAPEKIEKLATEISSLTLQEVCNLVDYLQDKLGVSAAAFAPAAAVGVAPGAPGAEAPASVEEEKTEFDVVIDEVPSNARIAVIKAVRTLTNLALKEAKDLIEGLPKKFKEGVSKDDAEAAKKQLEEAGAKF

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L7/L12	Seems to be the binding site for several of the factors involved in protein synthesis and appears to be essential for accurate translation.	probable	Q5N3N6
50S ribosomal protein L7/L12	Seems to be the binding site for several of the factors involved in protein synthesis and appears to be essential for accurate translation.	probable	B0CAD2
50S ribosomal protein L7/L12	Seems to be the binding site for several of the factors involved in protein synthesis and appears to be essential for accurate translation.	probable	Q31QK6

No EC number assigned to the protein, probably not an enzyme!

Template: 1DD3, chain A
Confidence level:very confident
Coverage over the Query: 23-130
View the alignment between query and template
View the model in PyMOL