Citrus Sinensis ID: 045375


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MALSNNVIGPINLVAVLLSIPVIGARIWLAIEADNSCVKLLQWPVIILGILILVVALAGFIGGFGASLGSLYFISLPCSFL
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
***SNNVIGPINLVAVLLSIPVIGARIWLAIEADNSCVKLLQWPVIILGILILVVALAGFIGGFGASLGSLYFISLPCSFL
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSNNVIGPINLVAVLLSIPVIGARIWLAIEADNSCVKLLQWPVIILGILILVVALAGFIGGFGASLGSLYFISLPCSFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TORNADO 2 Involved in the basipetal transport of auxin (IAA) that modulates growth and organs organization, as well as cell differentiation. Regulates shoot apical meristem (SAM) organization in the peripheral zone. Required for initial meristematic divisions in the epidermal/lateral root cap leading to the formation of epidermal cells and a clone of lateral root cap cells, as well as for the maintenance of the radial pattern of cell specification in the root, thus regulating the distinction between the lateral root cap and epidermis. Together with WIH peptides, promotes megasporogenesis.probableQ9FIQ5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted