Involved in the basipetal transport of auxin (IAA) that modulates growth and organs organization, as well as cell differentiation. Regulates shoot apical meristem (SAM) organization in the peripheral zone. Required for initial meristematic divisions in the epidermal/lateral root cap leading to the formation of epidermal cells and a clone of lateral root cap cells, as well as for the maintenance of the radial pattern of cell specification in the root, thus regulating the distinction between the lateral root cap and epidermis. Together with WIH peptides, promotes megasporogenesis. Arabidopsis thaliana (taxid: 3702)
Score = 92 (37.4 bits), Expect = 0.00058, P = 0.00058
Identities = 16/41 (39%), Positives = 25/41 (60%)
Query: 4 SNNVIGPINLVAVLLSIPVIGARIWLAIEADNSCVKLLQWP 44
SNN++G +N + LLSIP++ IWL+ + C + L P
Sbjct: 5 SNNLVGILNFLVFLLSIPILAGGIWLSQKGSTECERFLDKP 45
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.328 0.145 0.462 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 81 66 0.00091 102 3 11 22 0.38 28
29 0.48 28
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 7
No. of states in DFA: 523 (56 KB)
Total size of DFA: 92 KB (2066 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 5.76u 0.16s 5.92t Elapsed: 00:00:00
Total cpu time: 5.76u 0.16s 5.92t Elapsed: 00:00:01
Start: Sat May 11 15:12:27 2013 End: Sat May 11 15:12:28 2013
CD9 (also called DRAP-27, MRP-1 or p24) upregulates HB-EGF activity as a receptor for diphtheria toxin as well as its juxtacrine activity. CD9 mAbs modulate cell adhesion and migration and trigger platelet activation that is blocked by mAbs directed to the platelet Fc receptor CD32. In mice, CD9 mAb KMC8.8 has been shown to inhibit the production of myeloid cells in vitro and has a costimulatory activity for T cells. CD9 is a type III membrane protein, with four putative transmembrane domains. CD37 (or gp52-40) is involved in signal transduction and serves as a stable marker for malignancies derived from mature B cells, like B-CLL, HCL, and all types of B-NHL. CD63 transfection reduced melanoma cell motility on fibronectin, collagen and laminin, and reduced the growth and metastasis of melanoma cells in nude mice []. CD63 has been used as a marker for late endosomes and for primary melanomas. These proteins are all type II membrane proteins: they contain an N-terminal transmembrane (TM) domain, which acts both as a signal sequence and a membrane anchor, and 3 additional TM regions (hence the name 'TM4'). The sequences contain a number of conserved cysteine residues. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0016021 integral to membrane; PDB: 1IV5_A 1G8Q_A.
>KOG4433 consensus Tweety transmembrane/cell surface protein [General function prediction only]
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion
The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
>PF11297 DUF3098: Protein of unknown function (DUF3098); InterPro: IPR021448 This bacterial family of proteins has no known function