Citrus Sinensis ID: 045384

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQAETFSGQSSEANEQASSSQMSTAAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLWLYNGD
cccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
****PCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQ*******************************************************************YWSMEDLWLYN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQAETFSGQSSEANEQASSSQMSTAAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLWLYNGD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor MYB21 Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL.probableQ9LK95
Myb-related protein 340 Transcription factor.probableP81396
Myb-related protein 305 Transcription factor.probableP81391

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H89, chain C
Confidence level:very confident
Coverage over the Query: 7-115
View the alignment between query and template
View the model in PyMOL