Citrus Sinensis ID: 045384

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQAETFSGQSSEANEQASSSQMSTAAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLWLYNGD
cccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccHHcccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccc
mdktpcnsqeaevrkgpwtmeEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLnylrpdvkrgnitpEEQLLIMELHAKWGNRWSKIAkhlpgrtdneIKNFWRTRIQKQIKQAetfsgqsseaneqassSQMSTAAYtvedysapqyplnnnmdphqafpldnmapipsevnenywsmEDLWLYNGD
mdktpcnsqeaevrkgpwtmeEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLnylrpdvkrgnitPEEQLLIMELHAKWGNRWSKIAkhlpgrtdneiKNFWRTRIQKQIKQAETFSGQSSEANEQASSSQMSTAAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLWLYNGD
MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQAETFsgqsseaneqasssqmsTAAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLWLYNGD
****************PWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQ***************************************************************VNENYWSMEDLWLY***
*D*TPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQ**********************************************************************MEDLWLYN**
*************RKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIK***********************AAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLWLYNGD
****PCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQAETFSGQSS*****************************************************YWSMEDLWLYNG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQAETFSGQSSEANEQASSSQMSTAAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAPIPSEVNENYWSMEDLWLYNGD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query194 2.2.26 [Sep-21-2011]
P81396198 Myb-related protein 340 O N/A no 0.938 0.919 0.693 4e-71
P81391205 Myb-related protein 305 O N/A no 0.979 0.926 0.674 4e-71
Q9LK95226 Transcription factor MYB2 yes no 0.953 0.818 0.638 1e-65
Q9S9K9257 Transcription factor MYB3 no no 0.793 0.599 0.506 3e-39
P27898 399 Myb-related protein P OS= N/A no 0.597 0.290 0.632 4e-39
Q9LX82256 Transcription factor MYB4 no no 0.582 0.441 0.601 1e-38
Q4JL84235 Transcription factor MYB5 no no 0.567 0.468 0.609 1e-38
O22264 371 Transcription factor MYB1 no no 0.597 0.312 0.606 1e-38
P81395274 Myb-related protein 330 O N/A no 0.597 0.423 0.623 6e-38
Q38851236 Transcription repressor M no no 0.597 0.491 0.598 1e-37
>sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 Back     alignment and function desciption
 Score =  267 bits (682), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 158/196 (80%), Gaps = 14/196 (7%)

Query: 1   MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN 60
           MDK PCNS + EVRKGPWTMEEDLILIN+I+NHGEGVWN++A++AGLKRTGKSCRLRWLN
Sbjct: 1   MDKKPCNSHDVEVRKGPWTMEEDLILINFISNHGEGVWNTIARSAGLKRTGKSCRLRWLN 60

Query: 61  YLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFW-RTRIQKQIKQ 119
           YLRPDV+RGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+W RTRIQK IKQ
Sbjct: 61  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWNRTRIQKHIKQ 120

Query: 120 AE-TFSGQSS--EANEQASSSQMST---AAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAP 173
           AE +F G  +   +NEQAS+S +S+   A + VE YS+     N NM  +  +P      
Sbjct: 121 AEASFIGHINPEHSNEQASTSLLSSSCHADHAVESYSS---SFNGNMGNNVQYP----NH 173

Query: 174 IPSEVNENYWSMEDLW 189
            P+E N+ +WSMEDLW
Sbjct: 174 FPTESNDYFWSMEDLW 189
Transcription factor.
Antirrhinum majus (taxid: 4151)
>sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 Back     alignment and function description
>sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 Back     alignment and function description
>sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
225452426189 PREDICTED: myb-related protein 305 [Viti 0.953 0.978 0.732 8e-78
158323780189 R2R3 Myb24 transcription factor [Vitis v 0.953 0.978 0.727 4e-77
224055549190 predicted protein [Populus trichocarpa] 0.958 0.978 0.727 4e-74
170282616197 MYB-like protein NON1 [Petunia x hybrida 0.969 0.954 0.724 7e-74
315177951192 non-opening 1 [Nicotiana attenuata] 0.943 0.953 0.709 9e-74
156915045192 MYB305 protein v1 [Nicotiana langsdorffi 0.953 0.963 0.706 1e-73
156915043192 MYB305 protein v2 [Nicotiana langsdorffi 0.953 0.963 0.706 2e-73
237688238190 MYBF1 [Populus x canadensis] 0.958 0.978 0.722 3e-73
224140873190 predicted protein [Populus trichocarpa] 0.953 0.973 0.738 9e-73
40643882190 MYB8 protein [Gerbera hybrid cultivar] 0.917 0.936 0.730 1e-71
>gi|225452426|ref|XP_002277118.1| PREDICTED: myb-related protein 305 [Vitis vinifera] gi|147795417|emb|CAN77103.1| hypothetical protein VITISV_018445 [Vitis vinifera] gi|296087649|emb|CBI34905.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 164/198 (82%), Gaps = 13/198 (6%)

Query: 1   MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN 60
           MDK PCNSQ+AEVRKGPWT+EEDLILINYIANHGEGVWNSLAK+AGLKRTGKSCRLRWLN
Sbjct: 1   MDKKPCNSQDAEVRKGPWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLN 60

Query: 61  YLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQA 120
           YLRPDV+RGNIT EEQ LIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK IK A
Sbjct: 61  YLRPDVRRGNITDEEQQLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHIKNA 120

Query: 121 ETFSGQSSE-ANEQASSSQMSTAAYTVEDYSAPQYPLNNNMDPHQAFPLDNMAPIPSEVN 179
           ETF+ QSS+  ++QA++SQ+  AA+  + YS P YP N      +AFP     P  +E N
Sbjct: 121 ETFTAQSSDQTHDQATTSQVMGAAHVADSYSPPSYPAN-----LEAFP----GPSSAESN 171

Query: 180 ENYWSMEDLW---LYNGD 194
           +N+W+MED+W   L NGD
Sbjct: 172 DNFWTMEDIWSMQLLNGD 189

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|158323780|gb|ABW34394.1| R2R3 Myb24 transcription factor [Vitis vinifera] Back     alignment and taxonomy information
>gi|224055549|ref|XP_002298534.1| predicted protein [Populus trichocarpa] gi|222845792|gb|EEE83339.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|170282616|gb|ACB12237.1| MYB-like protein NON1 [Petunia x hybrida] gi|171919810|gb|ACB59077.1| Myb-like transcription factor EOBII [Petunia x hybrida] gi|330368857|gb|AEC11893.1| MYB transcription factor EOBII [Petunia axillaris] gi|330368859|gb|AEC11894.1| MYB transcription factor EOBII [Petunia exserta] Back     alignment and taxonomy information
>gi|315177951|gb|ADT82939.1| non-opening 1 [Nicotiana attenuata] Back     alignment and taxonomy information
>gi|156915045|gb|ABU97107.1| MYB305 protein v1 [Nicotiana langsdorffii x Nicotiana sanderae] Back     alignment and taxonomy information
>gi|156915043|gb|ABU97106.1| MYB305 protein v2 [Nicotiana langsdorffii x Nicotiana sanderae] Back     alignment and taxonomy information
>gi|237688238|gb|ACR15115.1| MYBF1 [Populus x canadensis] Back     alignment and taxonomy information
>gi|224140873|ref|XP_002323803.1| predicted protein [Populus trichocarpa] gi|222866805|gb|EEF03936.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|40643882|emb|CAD87008.1| MYB8 protein [Gerbera hybrid cultivar] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query194
TAIR|locus:2089159226 MYB21 "myb domain protein 21" 0.592 0.508 0.921 9.9e-62
TAIR|locus:2170573214 MYB24 "myb domain protein 24" 0.963 0.873 0.610 7.3e-59
TAIR|locus:2084168206 MYB57 "myb domain protein 57" 0.948 0.893 0.561 8e-53
TAIR|locus:2032975283 MYB116 "myb domain protein 116 0.603 0.413 0.731 2e-51
TAIR|locus:2199357286 MYB62 "myb domain protein 62" 0.577 0.391 0.741 4.7e-50
TAIR|locus:2084269 323 MYB108 "myb domain protein 108 0.567 0.340 0.754 7.9e-46
TAIR|locus:2065226273 MYB2 "AT2G47190" [Arabidopsis 0.592 0.421 0.686 2.1e-45
TAIR|locus:2202633243 MYB112 "myb domain protein 112 0.561 0.448 0.715 5.6e-45
TAIR|locus:2087183269 MYB305 "myb domain protein 305 0.541 0.390 0.723 5.2e-42
TAIR|locus:2140847261 MYB79 "myb domain protein 79" 0.541 0.402 0.723 8.4e-42
TAIR|locus:2089159 MYB21 "myb domain protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 588 (212.0 bits), Expect = 9.9e-62, Sum P(2) = 9.9e-62
 Identities = 106/115 (92%), Positives = 113/115 (98%)

Query:     7 NSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDV 66
             +S EAEVRKGPWTMEEDLILINYIANHG+GVWNSLAK+AGLKRTGKSCRLRWLNYLRPDV
Sbjct:    14 SSAEAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDV 73

Query:    67 KRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQAE 121
             +RGNITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK IKQ++
Sbjct:    74 RRGNITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQSD 128
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0048443 "stamen development" evidence=RCA;IMP
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=IEP
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=IEP
GO:0080086 "stamen filament development" evidence=IGI
GO:0048441 "petal development" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
TAIR|locus:2170573 MYB24 "myb domain protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084168 MYB57 "myb domain protein 57" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032975 MYB116 "myb domain protein 116" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199357 MYB62 "myb domain protein 62" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084269 MYB108 "myb domain protein 108" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065226 MYB2 "AT2G47190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202633 MYB112 "myb domain protein 112" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087183 MYB305 "myb domain protein 305" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140847 MYB79 "myb domain protein 79" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P81391MYB05_ANTMANo assigned EC number0.67460.97930.9268N/Ano
Q9LK95MYB21_ARATHNo assigned EC number0.63800.95360.8185yesno
P81396MYB40_ANTMANo assigned EC number0.69380.93810.9191N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 1e-44
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 9e-44
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 4e-14
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-11
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 5e-11
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 9e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 7e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 4e-05
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  148 bits (374), Expect = 1e-44
 Identities = 68/114 (59%), Positives = 87/114 (76%), Gaps = 1/114 (0%)

Query: 4   TPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLR 63
           TPC ++   +++GPWT+EED IL+++I   GEG W SL K AGL R GKSCRLRW+NYLR
Sbjct: 15  TPCCTKMG-MKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLR 73

Query: 64  PDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQI 117
           P VKRG IT +E+ LI+ LH   GNRWS IA  +PGRTDNEIKN+W T ++K++
Sbjct: 74  PSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKL 127

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 194
PLN03091 459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.85
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.81
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.74
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.64
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.64
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.58
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.54
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.49
PLN03212249 Transcription repressor MYB5; Provisional 99.35
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.34
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.31
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.29
PLN03091 459 hypothetical protein; Provisional 99.28
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.21
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.17
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.14
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.01
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.53
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.33
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.15
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.95
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.8
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.76
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.7
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.65
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.64
KOG1279506 consensus Chromatin remodeling factor subunit and 97.51
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.48
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.41
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.4
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.38
KOG1279 506 consensus Chromatin remodeling factor subunit and 97.27
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.18
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 97.1
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.06
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.82
PRK13923170 putative spore coat protein regulator protein YlbO 96.74
PRK13923170 putative spore coat protein regulator protein YlbO 96.72
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.46
PLN031421033 Probable chromatin-remodeling complex ATPase chain 96.26
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.17
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 94.5
KOG2656 445 consensus DNA methyltransferase 1-associated prote 94.36
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 93.97
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 93.86
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 93.43
KOG4282 345 consensus Transcription factor GT-2 and related pr 93.24
KOG1194 534 consensus Predicted DNA-binding protein, contains 93.02
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 92.53
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 92.47
KOG4282345 consensus Transcription factor GT-2 and related pr 91.5
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 89.72
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 89.4
KOG4167 907 consensus Predicted DNA-binding protein, contains 89.16
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 86.23
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 86.06
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 85.92
KOG4167 907 consensus Predicted DNA-binding protein, contains 83.95
smart0059589 MADF subfamily of SANT domain. 83.85
KOG4468 782 consensus Polycomb-group transcriptional regulator 82.69
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 80.74
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-38  Score=278.20  Aligned_cols=120  Identities=54%  Similarity=1.028  Sum_probs=116.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCcchhhhhhhhCCCcchhhhhhhhhhhcCCCccCCCCCHHHHHHHH
Q 045384            1 MDKTPCNSQEAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIM   80 (194)
Q Consensus         1 m~r~~~n~~~p~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qcr~R~~~~L~p~~~~~~WT~eEd~~Ll   80 (194)
                      |||++| |.++.++||+||+|||++|+++|++||..+|..||+.++++|+++|||+||.++|+|.+++++||+|||++|+
T Consensus         1 mgr~~C-c~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLL   79 (459)
T PLN03091          1 MGRHSC-CYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLII   79 (459)
T ss_pred             CCCCcc-CcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHH
Confidence            999999 9999999999999999999999999999999999999977899999999999999999999999999999999


Q ss_pred             HHHHhhcCcHHHHhhhCCCCCHHHHHHHHHHHHHHHHHhhh
Q 045384           81 ELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQAE  121 (194)
Q Consensus        81 ~~~~~~G~~W~~Ia~~l~gRt~~~~knrw~~~l~~~~~~~~  121 (194)
                      +++..||++|++||++|||||+++|||||+.+++++++...
T Consensus        80 eL~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~  120 (459)
T PLN03091         80 ELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRG  120 (459)
T ss_pred             HHHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcC
Confidence            99999999999999999999999999999999999887643

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 8e-22
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-21
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 3e-21
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 4e-21
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 8e-21
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 5e-16
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 7e-13
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 1e-11
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-08
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 2e-08
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 5e-06
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 9e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 1e-05
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 71/106 (66%), Gaps = 1/106 (0%)
Query: 12  EVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNI 71
           E+ KGPWT EED  +I ++  +G   W+ +AK     R GK CR RW N+L P+VK+ + 
Sbjct: 24  ELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLK-GRIGKQCRERWHNHLNPEVKKTSW 82
Query: 72  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQI 117
           T EE  +I + H + GNRW++IAK LPGRTDN +KN W + +++++
Sbjct: 83  TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV 128
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query194
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 4e-59
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 1e-58
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 1e-58
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 4e-55
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 1e-51
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-50
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-30
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-24
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-22
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-06
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 5e-19
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-05
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-15
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 6e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-14
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 2e-13
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 4e-13
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 9e-12
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 6e-09
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 3e-04
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-08
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 7e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 3e-08
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 8e-04
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 5e-07
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 1e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 6e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 9e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 6e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-06
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-05
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 3e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 2e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 9e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 8e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 1e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 3e-04
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 3e-04
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 8e-04
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 5e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  179 bits (457), Expect = 4e-59
 Identities = 49/106 (46%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 12  EVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNI 71
           E+ KGPWT EED  +I  +  +G   W+ +AK     R GK CR RW N+L P+VK+ + 
Sbjct: 1   ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSW 59

Query: 72  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQI 117
           T EE  +I + H + GNRW++IAK LPGRTDN IKN W + +++++
Sbjct: 60  TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 105
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.89
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.86
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.85
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.79
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.78
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.78
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.78
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.77
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.76
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.75
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.75
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.74
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.73
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.73
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.72
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.7
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.69
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.68
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.68
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.67
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.67
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.67
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.66
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.64
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.64
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.63
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.63
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.61
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.6
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.6
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.58
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.34
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.57
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.55
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.54
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.53
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.51
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.51
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.5
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.21
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.47
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.44
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.43
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.42
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.38
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.37
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.36
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.35
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.29
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.29
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.21
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.16
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.1
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.02
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.0
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.93
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.89
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.83
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.81
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.77
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.76
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.64
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.6
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.47
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.43
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.42
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.35
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.67
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.32
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.31
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.19
2crg_A70 Metastasis associated protein MTA3; transcription 98.07
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.03
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.96
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.87
2crg_A70 Metastasis associated protein MTA3; transcription 97.77
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.76
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.74
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.73
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.66
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 97.43
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.53
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.38
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.42
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 95.14
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.97
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 94.76
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.23
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 93.0
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 87.29
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 85.26
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=5e-37  Score=224.56  Aligned_cols=105  Identities=47%  Similarity=0.872  Sum_probs=99.6

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCcchhhhhhhhCCCcchhhhhhhhhhhcCCCccCCCCCHHHHHHHHHHHHhhcCcHH
Q 045384           12 EVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKWGNRWS   91 (194)
Q Consensus        12 ~~~kg~WT~eED~~L~~~v~~~g~~~W~~Ia~~~~~~Rt~~qcr~R~~~~L~p~~~~~~WT~eEd~~Ll~~~~~~G~~W~   91 (194)
                      ++++|+||+|||++|+++|+.||.++|..||+.|+ +|++.||++||.++|+|.+++++||+|||++|+++|..||.+|+
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W~   79 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWA   79 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCcHHHHhhhhc-CCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCHH
Confidence            47899999999999999999999888999999998 99999999999999999999999999999999999999999999


Q ss_pred             HHhhhCCCCCHHHHHHHHHHHHHHHH
Q 045384           92 KIAKHLPGRTDNEIKNFWRTRIQKQI  117 (194)
Q Consensus        92 ~Ia~~l~gRt~~~~knrw~~~l~~~~  117 (194)
                      .||++|||||+++|++||+.++++++
T Consensus        80 ~Ia~~l~gRt~~~~k~rw~~~~~~~~  105 (105)
T 1gv2_A           80 EIAKLLPGRTDNAIKNHWNSTMRRKV  105 (105)
T ss_dssp             HHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred             HHHHHcCCCCHHHHHHHHHHHHhccC
Confidence            99999999999999999999988753
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 194
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-18
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-09
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 3e-18
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-17
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-08
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-15
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-12
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 3e-14
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-06
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 7e-14
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 7e-12
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 5e-11
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 5e-11
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 4e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-10
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 7e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 8e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 2e-04
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 4e-06
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 4e-04
d1fexa_59 a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 96 3e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 73.6 bits (181), Expect = 1e-18
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 13 VRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPD 65
          + KGPWT EED  LI  +  +G   W+ +AK     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query194
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.82
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.82
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.78
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.76
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.71
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.7
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.68
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.64
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.62
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.62
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.57
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.56
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.55
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.55
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.54
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.49
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.48
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.47
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.43
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.43
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.4
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.35
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.31
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.26
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.2
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.15
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.07
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.54
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.46
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.43
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.19
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.76
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.16
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.15
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 97.03
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 96.33
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.25
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 94.2
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 93.86
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 91.75
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 91.47
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.82  E-value=1.2e-22  Score=141.50  Aligned_cols=71  Identities=18%  Similarity=0.270  Sum_probs=65.6

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCc-----chhhhhhhhCCCcchhhhhhhhhhhcCCCccCCCCCHHHHHHHHHHHHhh
Q 045384           15 KGPWTMEEDLILINYIANHGEG-----VWNSLAKAAGLKRTGKSCRLRWLNYLRPDVKRGNITPEEQLLIMELHAKW   86 (194)
Q Consensus        15 kg~WT~eED~~L~~~v~~~g~~-----~W~~Ia~~~~~~Rt~~qcr~R~~~~L~p~~~~~~WT~eEd~~Ll~~~~~~   86 (194)
                      |++||+|||++|+++|.+||..     +|..||+.|| +||++|||+||.++|+|.+++++||.+||.+|++.+..+
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~l   76 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNL   76 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCB
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhcc
Confidence            6899999999999999999864     4999999998 999999999999999999999999999999988766544
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure